@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : AA1R_HUMAN: (2016-01-08 )
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2CV_A_7(2Y02)
ADRB1_MELGA
[Raw transfer]




2CV_A_6(2Y03)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(2Y01)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(2Y00)
ADRB1_MELGA
[Raw transfer]




2CV_A_7(2Y04)
ADRB1_MELGA
[Raw transfer]




2CV_B_19(3ZPR)
ADRB1_MELGA
[Raw transfer]




2CV_A_12(4AMJ)
ADRB1_MELGA
[Raw transfer]




2CV_A_9(4AMJ)
ADRB1_MELGA
[Raw transfer]




2CV_A_8(3ZPQ)
ADRB1_MELGA
[Raw transfer]




OLB_A_3(4UG2)
?
[Raw transfer]




OLB_B_5(4UG2)
?
[Raw transfer]




STE_A_8(3VG9)
?
[Raw transfer]




STE_A_9(3VG9)
?
[Raw transfer]




STE_A_3(3EML)
ENLYS_BPT4
[Raw transfer]




2CV_B_12(2Y03)
ADRB1_MELGA
[Raw transfer]




79 HHSearch 97.2553%-171 - C5 -3EML 3.0 ENLYS_BPT4
2 PsiBlast_PDB 94.6451%-171 - C5 -3VGA - AA2AR_HUMAN -
1 PsiBlast_PDB 93.3651%-171 - C5 -3VG9 3.7 ?
5 PsiBlast_PDB 91.9950%-178 - C5 -4UG2 - ? -
3 PsiBlast_PDB 91.9950%-172 - C5 -2YDO - ? -
8 PsiBlast_PDB 91.7650%-169 - C5 -3REY - AA2AR_HUMAN -
6 PsiBlast_PDB 91.7350%-172 - C5 -4UHR - AA2AR_HUMAN -
4 PsiBlast_PDB 91.5450%-174 - C5 -2YDV - ? -
7 PsiBlast_PDB 91.3950%-168 - C5 -3PWH - ? -
11 PsiBlast_PDB 90.7150%-169 - C5 -3UZC - AA2AR_HUMAN -
9 PsiBlast_PDB 90.7150%-168 - C5 -3RFM - AA2AR_HUMAN -
10 PsiBlast_PDB 90.5250%-169 - C5 -3UZA - AA2AR_HUMAN -
21 PsiBlast_CBE 88.4050%-180 - C5 -4UG2 5.0 ?
82 HHSearch 78.8629%-145 * C5 *2RH1 - ADRB2_HUMAN (first) -
25 PsiBlast_CBE 76.1934%-167 - C5 -2YCW - ADRB1_MELGA -
35 PsiBlast_CBE 76.1034%-174 - C5 -3ZPQ - ADRB1_MELGA -
32 PsiBlast_CBE 76.0834%-167 - C5 -3ZPR 2.5 ADRB1_MELGA
80 HHSearch 75.8630%-149 - C5 -3RZE - ENLYS_BPT4 (first) -
30 PsiBlast_CBE 75.8334%-171 - C5 -4AMJ 2.2 ADRB1_MELGA
83 HHSearch 75.7129%-153 - C5 -3PBL - DRD3_HUMAN (first) -
34 PsiBlast_CBE 75.5234%-168 - C5 -3ZPQ 3.6 ADRB1_MELGA
39 PsiBlast_CBE 75.2534%-165 - C5 -2Y01 2.6 ADRB1_MELGA
40 PsiBlast_CBE 75.1834%-165 - C5 -2Y00 2.3 ADRB1_MELGA
29 PsiBlast_CBE 74.5034%-167 - C5 -4AMJ 3.4 ADRB1_MELGA
37 PsiBlast_CBE 74.4334%-163 - C5 -2Y03 2.6 ADRB1_MELGA
36 PsiBlast_CBE 74.2734%-166 - C5 -2Y04 2.4 ADRB1_MELGA
38 PsiBlast_CBE 74.2034%-165 - C5 -2Y02 2.5 ADRB1_MELGA
20 PsiBlast_PDB 73.7834%-174 - C5 -2Y03 1.9 ADRB1_MELGA