@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK20_HUMAN: (2015-10-05 )
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG

Atome Classification :

(97 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EZV_C_8(3F5X)
CDK2_HUMAN
[Raw transfer]




EZV_A_6(3F5X)
CDK2_HUMAN
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




CK7_C_8(2WEV)
CDK2_HUMAN
[Raw transfer]




L0H_A_2(2W1H)
CDK2_HUMAN
[Raw transfer]




NS9_A_2(3NS9)
CDK2_HUMAN
[Raw transfer]




FRV_A_3(2W06)
CDK2_HUMAN
[Raw transfer]




5BP_A_5(3EJ1)
CDK2_HUMAN
[Raw transfer]




889_A_6(2WPA)
CDK2_HUMAN
[Raw transfer]




P48_A_5(2WIH)
CDK2_HUMAN
[Raw transfer]




889_C_7(2WPA)
CDK2_HUMAN
[Raw transfer]




LZ8_A_2(2VTO)
CDK2_HUMAN
[Raw transfer]




CDK_A_2(2XMY)
CDK2_HUMAN
[Raw transfer]




1QK_A_3(4KD1)
CDK2_HUMAN
[Raw transfer]




SBC_C_8(2BKZ)
CDK2_HUMAN
[Raw transfer]




FRT_A_2(2W05)
CDK2_HUMAN
[Raw transfer]




P48_C_6(2WIH)
CDK2_HUMAN
[Raw transfer]




CK7_A_7(2WEV)
CDK2_HUMAN
[Raw transfer]




X1N_A_6(2X1N)
CDK2_HUMAN
[Raw transfer]




INR_B_4(1V0O)
CDC2H_PLAFK
[Raw transfer]




3TI_A_2(3TIZ)
CDK2_HUMAN
[Raw transfer]




Y8L_A_2(2XNB)
CDK2_HUMAN
[Raw transfer]




A07_A_2(3LFS)
CDK2_HUMAN
[Raw transfer]




SBC_A_7(2BKZ)
CDK2_HUMAN
[Raw transfer]




P49_C_6(2WIP)
CDK2_HUMAN
[Raw transfer]




WXV_A_5(2WXV)
CDK2_HUMAN
[Raw transfer]




A27_A_2(3LFN)
CDK2_HUMAN
[Raw transfer]




PO5_A_5(3EID)
CDK2_HUMAN
[Raw transfer]




LZ3_A_2(2VTI)
CDK2_HUMAN
[Raw transfer]




P49_A_5(2WIP)
CDK2_HUMAN
[Raw transfer]




PDY_A_3(3WBL)
CDK2_HUMAN
[Raw transfer]




1N3_A_2(3ULI)
CDK2_HUMAN
[Raw transfer]




514_A_7(2C4G)
CDK2_HUMAN
[Raw transfer]




X1N_C_7(2X1N)
CDK2_HUMAN
[Raw transfer]




WXV_C_6(2WXV)
CDK2_HUMAN
[Raw transfer]




INR_A_3(1V0O)
CDC2H_PLAFK
[Raw transfer]




0BX_A_2(3UNJ)
CDK2_HUMAN
[Raw transfer]




514_C_8(2C4G)
CDK2_HUMAN
[Raw transfer]




LZ9_A_2(2VTP)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




56H_A_2(5D1J)
?
[Raw transfer]




PVB_B_4(1V0P)
CDC2H_PLAFK
[Raw transfer]




T2A_A_5(3EOC)
CDK2_HUMAN
[Raw transfer]




B49_A_2(3TI1)
CDK2_HUMAN
[Raw transfer]




T2A_C_6(3EOC)
CDK2_HUMAN
[Raw transfer]




A28_A_2(3LFQ)
CDK2_HUMAN
[Raw transfer]




60K_A_5(4FX3)
CDK2_HUMAN
[Raw transfer]




3I6_A_2(4BGH)
CDK2_HUMAN
[Raw transfer]




LZ5_A_2(2VTL)
CDK2_HUMAN
[Raw transfer]




1YG_A_2(4LYN)
CDK2_HUMAN
[Raw transfer]




60K_C_8(4FX3)
CDK2_HUMAN
[Raw transfer]




292_C_8(1VYW)
CDK2_HUMAN
[Raw transfer]




PVB_A_3(1V0P)
CDC2H_PLAFK
[Raw transfer]




529_C_8(2BPM)
CDK2_HUMAN
[Raw transfer]




LZA_A_2(2VTQ)
CDK2_HUMAN
[Raw transfer]




ADP_A_5(4NST)
CDK12_HUMAN
[Raw transfer]




LZC_A_2(2VTS)
CDK2_HUMAN
[Raw transfer]




LZE_A_2(2VU3)
CDK2_HUMAN
[Raw transfer]




529_A_7(2BPM)
CDK2_HUMAN
[Raw transfer]




0BY_A_2(3UNK)
CDK2_HUMAN
[Raw transfer]




292_A_7(1VYW)
CDK2_HUMAN
[Raw transfer]




D6I_A_3(4BZD)
CDK2_HUMAN
[Raw transfer]




LZ9_A_4(4Y72)
?
[Raw transfer]




LZ7_A_2(2VTN)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




DTQ_B_2(1DI8)
CDK2_HUMAN
[Raw transfer]




LQ5_A_2(5A14)
?
[Raw transfer]




LZ1_A_2(2VTA)
CDK2_HUMAN
[Raw transfer]




B98_A_2(3FZ1)
CDK2_HUMAN
[Raw transfer]




C53_A_2(2V0D)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




PMU_A_2(3S2P)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1FIN)
CDK2_HUMAN
[Raw transfer]




PVB_A_2(1CKP)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(2VTA)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(4FKW)
CDK2_HUMAN
[Raw transfer]




ESJ_A_2(4D1X)
CDK2_HUMAN
[Raw transfer]




GOL_A_2(2VTJ)
CDK2_HUMAN
[Raw transfer]




LZ4_A_3(2VTJ)
CDK2_HUMAN
[Raw transfer]




0SR_A_3(4F6U)
CDK8_HUMAN
[Raw transfer]




LZ6_A_2(2VTM)
CDK2_HUMAN
[Raw transfer]




LZB_A_2(2VTR)
CDK2_HUMAN
[Raw transfer]




LZ2_A_2(2VTH)
CDK2_HUMAN
[Raw transfer]




TIY_A_14(3TIY)
CDK2_HUMAN
[Raw transfer]




GOL_A_3(4FKQ)
CDK2_HUMAN
[Raw transfer]




19K_A_2(3SW7)
CDK2_HUMAN
[Raw transfer]




61K_A_2(4FKV)
CDK2_HUMAN
[Raw transfer]




I19_A_3(2W17)
CDK2_HUMAN
[Raw transfer]




EDO_A_3(1CKP)
CDK2_HUMAN
[Raw transfer]




EFP_A_2(3IG7)
CDK2_HUMAN
[Raw transfer]




20K_A_2(4FKO)
CDK2_HUMAN
[Raw transfer]




42K_A_2(4FKQ)
CDK2_HUMAN
[Raw transfer]




03K_A_2(4EK5)
CDK2_HUMAN
[Raw transfer]




EFQ_A_2(3IGG)
CDK2_HUMAN
[Raw transfer]




10K_A_2(4EK6)
CDK2_HUMAN
[Raw transfer]




IM9_A_2(2VV9)
CDK2_HUMAN
[Raw transfer]




62K_A_2(4FKW)
CDK2_HUMAN
[Raw transfer]




11K_A_2(4FKJ)
CDK2_HUMAN
[Raw transfer]




45K_A_2(4FKR)
CDK2_HUMAN
[Raw transfer]




4CK_A_2(4FKG)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




EDO_A_10(3TIZ)
CDK2_HUMAN
[Raw transfer]




AF3_A_6(4NST)
CDK12_HUMAN
[Raw transfer]




33 PsiBlast_CBE 95.6443%-129 - C1 -4LYN 6.6 CDK2_HUMAN
76 PsiBlast_CBE 94.9143%-125 - C1 -2XNB 7.7 CDK2_HUMAN
82 PsiBlast_CBE 94.8243%-129 - C1 -2W1H 6.5 CDK2_HUMAN
52 PsiBlast_CBE 94.6843%-131 - C1 -4BGH 5.7 CDK2_HUMAN
97 PsiBlast_CBE 94.6743%-131 - C1 -2VTI 4.9 CDK2_HUMAN
88 PsiBlast_CBE 94.6443%-128 - C1 -2VTS 6.2 CDK2_HUMAN
99 PsiBlast_CBE 94.5443%-132 - C1 -2VTA 3.1 CDK2_HUMAN
55 PsiBlast_CBE 94.4843%-125 - C1 -3UNJ 6.2 CDK2_HUMAN
34 PsiBlast_CBE 94.4743%-124 - C1 -4KD1 8.2 CDK2_HUMAN
95 PsiBlast_CBE 94.4343%-125 - C1 -2VTL 3.5 CDK2_HUMAN
36 PsiBlast_CBE 94.2743%-125 - C1 -4FX3 5.9 CDK2_HUMAN
92 PsiBlast_CBE 94.2443%-129 - C1 -2VTO 4.7 CDK2_HUMAN
98 PsiBlast_CBE 94.2343%-131 - C1 -2VTH 3.4 CDK2_HUMAN
84 PsiBlast_CBE 94.2043%-128 - C1 -2W06 6.9 CDK2_HUMAN
57 PsiBlast_CBE 94.1943%-125 - C1 -3TIZ 5.3 CDK2_HUMAN
74 PsiBlast_CBE 93.9943%-121 - C1 -3EJ1 5.8 CDK2_HUMAN
94 PsiBlast_CBE 93.9543%-125 - C1 -2VTM 3.3 CDK2_HUMAN
59 PsiBlast_CBE 93.9543%-124 - C1 -3TI1 6.1 CDK2_HUMAN
20 PsiBlast_PDB 93.9443%-130 - C1 -1DI8 6.1 CDK2_HUMAN
13 PsiBlast_PDB 93.9243%-122 - C1 -2WIH 8.4 CDK2_HUMAN
64 PsiBlast_CBE 93.9043%-128 - C1 -3LFS 5.8 CDK2_HUMAN
12 PsiBlast_PDB 93.8543%-119 - C1 -2BKZ 5.0 CDK2_HUMAN
65 PsiBlast_CBE 93.8443%-128 - C1 -3LFQ 5.8 CDK2_HUMAN
66 PsiBlast_CBE 93.7143%-126 - C1 -3LFN 8.0 CDK2_HUMAN
35 PsiBlast_CBE 93.7143%-123 - C1 -4FX3 6.4 CDK2_HUMAN
29 PsiBlast_CBE 93.6343%-119 - C1 -2BKZ 4.8 CDK2_HUMAN
89 PsiBlast_CBE 93.5443%-122 - C1 -2VTR 5.3 CDK2_HUMAN
16 PsiBlast_PDB 93.4043%-120 - C1 -2WXV 6.9 CDK2_HUMAN
27 PsiBlast_CBE 93.3843%-121 - C1 -2C4G 5.4 CDK2_HUMAN
58 PsiBlast_CBE 93.3343%-126 - C1 -3TIY 3.8 CDK2_HUMAN
23 PsiBlast_CBE 93.2843%-123 - C1 -2WXV 7.1 CDK2_HUMAN
18 PsiBlast_PDB 93.2743%-130 - C1 -1CKP 5.0 CDK2_HUMAN
10 PsiBlast_PDB 93.2743%-118 - C1 -2C4G 5.4 CDK2_HUMAN
91 PsiBlast_CBE 93.0743%-129 - C1 -2VTP 4.7 CDK2_HUMAN
30 PsiBlast_CBE 93.0643%-124 - C1 -1VYW 6.4 CDK2_HUMAN
77 PsiBlast_CBE 92.9643%-124 - C1 -2XMY 5.9 CDK2_HUMAN
28 PsiBlast_CBE 92.8843%-123 - C1 -2BPM 5.8 CDK2_HUMAN
100 PsiBlast_CBE 92.8543%-126 - C1 -2V0D 2.3 CDK2_HUMAN
26 PsiBlast_CBE 92.8443%-123 - C1 -2WIH 8.5 CDK2_HUMAN
17 PsiBlast_PDB 92.7743%-120 - C1 -1FIN 3.7 CDK2_HUMAN
70 PsiBlast_CBE 92.6943%-118 - C1 -3F5X 8.4 CDK2_HUMAN
69 PsiBlast_CBE 92.6343%-127 - C1 -3FZ1 3.8 CDK2_HUMAN
24 PsiBlast_CBE 92.6343%-123 - C1 -2WPA 6.4 CDK2_HUMAN
9 PsiBlast_PDB 92.5243%-120 - C1 -1VYW 6.6 CDK2_HUMAN
15 PsiBlast_PDB 92.4843%-120 - C1 -2WPA 6.3 CDK2_HUMAN
54 PsiBlast_CBE 92.4643%-125 - C1 -3UNK 6.8 CDK2_HUMAN
75 PsiBlast_CBE 92.3943%-125 - C1 -3EID 7.3 CDK2_HUMAN
53 PsiBlast_CBE 92.3443%-130 - C1 -3WBL 5.5 CDK2_HUMAN
96 PsiBlast_CBE 92.3343%-128 - C1 -2VTJ 3.8 CDK2_HUMAN
81 PsiBlast_CBE 92.3343%-122 - C1 -2WEV 6.3 CDK2_HUMAN
11 PsiBlast_PDB 92.3143%-119 - C1 -2BPM 5.9 CDK2_HUMAN
79 PsiBlast_CBE 92.2243%-119 - C1 -2X1N 6.8 CDK2_HUMAN
51 PsiBlast_CBE 92.2243%-126 - C1 -4BZD 7.7 CDK2_HUMAN
72 PsiBlast_CBE 92.2043%-123 - C1 -3EOC 5.9 CDK2_HUMAN
73 PsiBlast_CBE 92.1243%-121 - C1 -3EOC 7.1 CDK2_HUMAN
90 PsiBlast_CBE 91.9443%-128 - C1 -2VTQ 5.6 CDK2_HUMAN
80 PsiBlast_CBE 91.9343%-122 - C1 -2WEV 6.3 CDK2_HUMAN
50 PsiBlast_CBE 91.8443%-129 - C1 -4D1X 4.7 CDK2_HUMAN
32 PsiBlast_CBE 91.8243%-126 - C1 -5A14 10.2 ?
25 PsiBlast_CBE 91.6843%-125 - C1 -2WIP 7.4 CDK2_HUMAN
62 PsiBlast_CBE 91.6243%-129 - C1 -3S2P 4.0 CDK2_HUMAN
63 PsiBlast_CBE 91.5443%-125 - C1 -3NS9 7.5 CDK2_HUMAN
56 PsiBlast_CBE 91.5443%-132 - C1 -3ULI 6.6 CDK2_HUMAN
78 PsiBlast_CBE 91.4543%-121 - C1 -2X1N 6.7 CDK2_HUMAN
87 PsiBlast_CBE 91.2543%-121 - C1 -2VU3 6.3 CDK2_HUMAN
14 PsiBlast_PDB 91.2343%-123 - C1 -2WIP 7.4 CDK2_HUMAN
93 PsiBlast_CBE 90.6143%-125 - C1 -2VTN 4.3 CDK2_HUMAN
71 PsiBlast_CBE 90.1943%-121 - C1 -3F5X 7.6 CDK2_HUMAN
1 PsiBlast_PDB 88.8245%-116 - C1 -1V0O 6.2 CDC2H_PLAFK
4 PsiBlast_PDB 88.7744%-121 - C1 -1V0P 8.1 CDC2H_PLAFK
123 HHSearch 88.3746%-115 - C1 -4AU8 4.9 CDK5_HUMAN
85 PsiBlast_CBE 88.3043%-128 - C1 -2W05 6.8 CDK2_HUMAN
129 HHSearch 87.8645%-122 - C1 -3NIZ 4.1 ?
8 PsiBlast_PDB 87.5343%-123 - C1 -4Y72 6.5 ?
21 PsiBlast_CBE 87.1945%-119 - C1 -1V0O 6.2 CDC2H_PLAFK
127 HHSearch 86.7141%-127 - C1 -4NST 4.9 CDK12_HUMAN
6 PsiBlast_PDB 86.3144%-124 - C1 -3NIZ 4.1 ?
22 PsiBlast_CBE 86.2444%-126 - C1 -1V0P 7.2 CDC2H_PLAFK
111 HHSearch 86.2343%-110 - C1 -1UA2 4.9 CDK7_HUMAN
31 PsiBlast_CBE 86.1843%-128 - C1 -5D1J 6.7 ?
125 HHSearch 80.2540%-123 - C1 -4BGQ 7.4 CDKL5_HUMAN
133 HHSearch 71.7934%-123 - C1 -4F6U 8.8 CDK8_HUMAN
113 HHSearch 60.1843% -3 - C1 -4EK4 3.5 CDK2_HUMAN
42 PsiBlast_CBE 58.3943% -3 - C1 -4FKO 4.9 CDK2_HUMAN
44 PsiBlast_CBE 58.2643% -5 - C1 -4FKJ 5.2 CDK2_HUMAN
48 PsiBlast_CBE 58.2343% -3 - C1 -4EK5 4.2 CDK2_HUMAN
45 PsiBlast_CBE 57.6143% -1 - C1 -4FKG 4.2 CDK2_HUMAN
39 PsiBlast_CBE 57.3343% -6 - C1 -4FKR 5.1 CDK2_HUMAN
67 PsiBlast_CBE 57.0843% -4 - C1 -3IGG 5.7 CDK2_HUMAN
47 PsiBlast_CBE 56.9343% -7 - C1 -4EK6 4.1 CDK2_HUMAN
38 PsiBlast_CBE 56.3343% -7 - C1 -4FKV 1.9 CDK2_HUMAN
68 PsiBlast_CBE 55.7743% -4 - C1 -3IG7 5.9 CDK2_HUMAN
40 PsiBlast_CBE 55.7443% -8 - C1 -4FKQ 4.7 CDK2_HUMAN
37 PsiBlast_CBE 52.5443% -4 - C1 -4FKW 2.7 CDK2_HUMAN
60 PsiBlast_CBE 52.3543% -8 - C1 -3SW7 4.5 CDK2_HUMAN
86 PsiBlast_CBE 52.1043% -5 - C1 -2VV9 6.0 CDK2_HUMAN
83 PsiBlast_CBE 51.0643% -5 - C1 -2W17 2.3 CDK2_HUMAN