@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK9_HUMAN: (2015-10-05 )
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Atome Classification :

(97 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

T3C_A_3(4BCG)
CDK9_HUMAN
[Raw transfer]




ATP_A_4(3BLQ)
CDK9_HUMAN
[Raw transfer]




ADP_A_5(4NST)
CDK12_HUMAN
[Raw transfer]




ANP_A_7(1CM8)
MK12_HUMAN
[Raw transfer]




ANP_A_5(4CXA)
CDK12_HUMAN
[Raw transfer]




38R_A_3(4BGQ)
CDKL5_HUMAN
[Raw transfer]




SBC_A_7(2BKZ)
CDK2_HUMAN
[Raw transfer]




SBC_C_8(2BKZ)
CDK2_HUMAN
[Raw transfer]




ADP_A_5(4NST)
CDK12_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




ANP_A_4(3MIA)
CDK9_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




WXV_C_6(2WXV)
CDK2_HUMAN
[Raw transfer]




P48_C_6(2WIH)
CDK2_HUMAN
[Raw transfer]




T9N_A_3(4BCJ)
CDK9_HUMAN
[Raw transfer]




3O0_B_5(3O0G)
CDK5_HUMAN
[Raw transfer]




P48_A_5(2WIH)
CDK2_HUMAN
[Raw transfer]




WXV_A_5(2WXV)
CDK2_HUMAN
[Raw transfer]




F18_A_3(3TNH)
CDK9_HUMAN
[Raw transfer]




P49_A_5(2WIP)
CDK2_HUMAN
[Raw transfer]




T3E_A_3(4BCI)
CDK9_HUMAN
[Raw transfer]




Z14_A_3(3R83)
CDK2_HUMAN
[Raw transfer]




P49_C_6(2WIP)
CDK2_HUMAN
[Raw transfer]




SLQ_A_3(3LQ5)
CDK9_HUMAN
[Raw transfer]




INR_B_4(1V0O)
CDC2H_PLAFK
[Raw transfer]




Z62_A_2(3R8V)
CDK2_HUMAN
[Raw transfer]




56Z_A_2(3S1H)
CDK2_HUMAN
[Raw transfer]




03Z_A_2(3RAK)
CDK2_HUMAN
[Raw transfer]




X64_A_6(4GCJ)
CDK2_HUMAN
[Raw transfer]




99Z_A_3(3SQQ)
CDK2_HUMAN
[Raw transfer]




20Z_A_2(3RMF)
CDK2_HUMAN
[Raw transfer]




889_A_6(2WPA)
CDK2_HUMAN
[Raw transfer]




04Z_A_2(3RAL)
CDK2_HUMAN
[Raw transfer]




PVB_B_4(1V0P)
CDC2H_PLAFK
[Raw transfer]




08Z_A_3(3RK7)
CDK2_HUMAN
[Raw transfer]




07Z_A_2(3RK5)
CDK2_HUMAN
[Raw transfer]




PVB_A_3(1V0P)
CDC2H_PLAFK
[Raw transfer]




X85_A_3(3RAI)
CDK2_HUMAN
[Raw transfer]




RRC_A_5(1UNL)
CDK5_HUMAN
[Raw transfer]




Z68_A_2(3R9N)
CDK2_HUMAN
[Raw transfer]




26Z_A_3(3RPV)
CDK2_HUMAN
[Raw transfer]




889_C_7(2WPA)
CDK2_HUMAN
[Raw transfer]




27Z_A_2(3RPY)
CDK2_HUMAN
[Raw transfer]




514_C_8(2C4G)
CDK2_HUMAN
[Raw transfer]




X6B_A_2(3R9D)
CDK2_HUMAN
[Raw transfer]




Z31_A_2(3R8U)
CDK2_HUMAN
[Raw transfer]




Z71_A_2(3R9O)
CDK2_HUMAN
[Raw transfer]




Z67_A_2(3R9H)
CDK2_HUMAN
[Raw transfer]




O1Z_A_2(3RAH)
CDK2_HUMAN
[Raw transfer]




514_A_7(2C4G)
CDK2_HUMAN
[Raw transfer]




02Z_A_2(3RZB)
CDK2_HUMAN
[Raw transfer]




INR_A_3(1V0O)
CDC2H_PLAFK
[Raw transfer]




09Z_A_2(3RK9)
CDK2_HUMAN
[Raw transfer]




STU_A_2(4EZ7)
CDK2_HUMAN
[Raw transfer]




25Z_A_2(3RPR)
CDK2_HUMAN
[Raw transfer]




CPB_A_6(3BLR)
CDK9_HUMAN
[Raw transfer]




X86_A_3(3R71)
CDK2_HUMAN
[Raw transfer]




ALH_A_5(1UNG)
CDK5_HUMAN
[Raw transfer]




292_C_8(1VYW)
CDK2_HUMAN
[Raw transfer]




Z63_A_2(3R8Z)
CDK2_HUMAN
[Raw transfer]




292_A_7(1VYW)
CDK2_HUMAN
[Raw transfer]




529_C_8(2BPM)
CDK2_HUMAN
[Raw transfer]




24Z_A_3(3RPO)
CDK2_HUMAN
[Raw transfer]




06Z_A_2(3RJC)
CDK2_HUMAN
[Raw transfer]




Z30_A_2(3R8L)
CDK2_HUMAN
[Raw transfer]




529_A_7(2BPM)
CDK2_HUMAN
[Raw transfer]




Z46_A_2(3R8P)
CDK2_HUMAN
[Raw transfer]




Z3R_B_10(4AU8)
CDK5_HUMAN
[Raw transfer]




Z04_A_3(3R7Y)
CDK2_HUMAN
[Raw transfer]




21Z_A_2(3RNI)
CDK2_HUMAN
[Raw transfer]




Z19_A_3(3R8M)
CDK2_HUMAN
[Raw transfer]




X87_A_3(3R73)
CDK2_HUMAN
[Raw transfer]




19Z_A_3(3RM7)
CDK2_HUMAN
[Raw transfer]




LZ9_A_4(4Y72)
?
[Raw transfer]




50Z_A_2(3S0O)
CDK2_HUMAN
[Raw transfer]




Z60_A_2(3S00)
CDK2_HUMAN
[Raw transfer]




X72_A_3(3QZI)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




Z02_A_3(3R7V)
CDK2_HUMAN
[Raw transfer]




12Z_A_3(3RKB)
CDK2_HUMAN
[Raw transfer]




X69_A_3(3QZH)
CDK2_HUMAN
[Raw transfer]




X84_A_3(3R6X)
CDK2_HUMAN
[Raw transfer]




18Z_A_3(3RM6)
CDK2_HUMAN
[Raw transfer]




22Z_A_3(3ROY)
CDK2_HUMAN
[Raw transfer]




X88_A_3(3R7E)
CDK2_HUMAN
[Raw transfer]




X76_A_3(3R1Y)
CDK2_HUMAN
[Raw transfer]




X75_A_3(3R1Q)
CDK2_HUMAN
[Raw transfer]




X73_A_3(3R1S)
CDK2_HUMAN
[Raw transfer]




XA0_A_3(3R28)
CDK2_HUMAN
[Raw transfer]




0S0_A_2(4EZ3)
CDK2_HUMAN
[Raw transfer]




X96_A_3(3R7U)
CDK2_HUMAN
[Raw transfer]




RFZ_A_5(3MY1)
CDK9_HUMAN
[Raw transfer]




0SR_A_3(4F6U)
CDK8_HUMAN
[Raw transfer]




X9I_A_3(3R7I)
CDK2_HUMAN
[Raw transfer]




2AN_A_3(4EZ7)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




EDO_A_3(4EZ3)
CDK2_HUMAN
[Raw transfer]




AF3_A_6(4NST)
CDK12_HUMAN
[Raw transfer]




AF3_A_6(4NST)
CDK12_HUMAN
[Raw transfer]




13 PsiBlast_PDB 95.6199%-131 - C1 -4BCG 6.4 CDK9_HUMAN
5 PsiBlast_PDB 94.6599%-136 - C1 -3BLQ 4.0 CDK9_HUMAN
4 PsiBlast_PDB 93.6399%-125 - C1 -3MIA 3.8 CDK9_HUMAN
9 PsiBlast_PDB 92.4099%-136 - C1 -3TNH 4.4 CDK9_HUMAN
11 PsiBlast_PDB 91.8599%-127 - C1 -4BCI 5.8 CDK9_HUMAN
6 PsiBlast_PDB 91.8499%-128 - C1 -3BLR 7.5 CDK9_HUMAN
7 PsiBlast_PDB 91.6099%-123 - C1 -3MY1 4.9 CDK9_HUMAN
12 PsiBlast_PDB 91.1799%-126 - C1 -4BCJ 5.6 CDK9_HUMAN
8 PsiBlast_PDB 91.0599%-129 - C1 -3LQ5 6.9 CDK9_HUMAN
115 HHSearch 71.2348%-117 - C1 -4NST 4.7 CDK12_HUMAN
15 PsiBlast_PDB 70.9245%-110 - C1 -4CXA 5.2 CDK12_HUMAN
16 PsiBlast_PDB 69.2645%-111 - C1 -4NST 5.1 CDK12_HUMAN
31 PsiBlast_CBE 67.7940%-118 - C1 -1V0P 8.0 CDC2H_PLAFK
19 PsiBlast_PDB 65.7340%-119 - C1 -3NIZ 4.2 ?
89 PsiBlast_CBE 65.0439%-111 - C1 -3R83 5.4 CDK2_HUMAN
78 PsiBlast_CBE 64.7339%-112 - C1 -3RAH 6.5 CDK2_HUMAN
24 PsiBlast_CBE 64.3541%-115 - C1 -4Y72 6.3 ?
96 PsiBlast_CBE 64.3239%-111 - C1 -3R71 5.3 CDK2_HUMAN
93 PsiBlast_CBE 64.3239%-112 - C1 -3R7I 4.9 CDK2_HUMAN
83 PsiBlast_CBE 64.2639%-114 - C1 -3R8Z 4.2 CDK2_HUMAN
64 PsiBlast_CBE 64.2239%-111 - C1 -3RPO 5.3 CDK2_HUMAN
86 PsiBlast_CBE 64.1139%-112 - C1 -3R8P 3.9 CDK2_HUMAN
80 PsiBlast_CBE 64.0339%-111 - C1 -3R9N 5.7 CDK2_HUMAN
133 HHSearch 63.9941%-109 - C1 -4AU8 4.9 CDK5_HUMAN
63 PsiBlast_CBE 63.7539%-112 - C1 -3RPR 6.9 CDK2_HUMAN
28 PsiBlast_CBE 63.7540%-118 - C1 -1V0O 6.4 CDC2H_PLAFK
59 PsiBlast_CBE 63.6839%-110 - C1 -3S00 4.5 CDK2_HUMAN
92 PsiBlast_CBE 63.6539%-111 - C1 -3R7U 5.1 CDK2_HUMAN
116 HHSearch 63.5941% -99 - C1 -1UA2 5.2 CDK7_HUMAN
25 PsiBlast_CBE 63.5241%-112 - C1 -4AU8 4.9 CDK5_HUMAN
90 PsiBlast_CBE 63.5039%-112 - C1 -3R7Y 5.3 CDK2_HUMAN
77 PsiBlast_CBE 63.3839%-110 - C1 -3RAI 5.2 CDK2_HUMAN
29 PsiBlast_CBE 63.3740%-115 - C1 -1V0O 6.0 CDC2H_PLAFK
101 PsiBlast_CBE 63.2439%-109 - C1 -3R1Q 5.5 CDK2_HUMAN
94 PsiBlast_CBE 63.2439%-112 - C1 -3R7E 4.4 CDK2_HUMAN
103 PsiBlast_CBE 63.1939%-109 - C1 -3QZH 4.7 CDK2_HUMAN
58 PsiBlast_CBE 63.1539%-112 - C1 -3S0O 4.7 CDK2_HUMAN
49 PsiBlast_CBE 63.1140%-112 - C1 -1UNL 7.2 CDK5_HUMAN
102 PsiBlast_CBE 62.9939%-110 - C1 -3QZI 5.3 CDK2_HUMAN
99 PsiBlast_CBE 62.8539%-110 - C1 -3R1Y 4.3 CDK2_HUMAN
52 PsiBlast_CBE 62.8340%-117 - C1 -1UNG 5.1 CDK5_HUMAN
100 PsiBlast_CBE 62.8039%-109 - C1 -3R1S 5.0 CDK2_HUMAN
85 PsiBlast_CBE 62.7839%-108 - C1 -3R8U 5.5 CDK2_HUMAN
84 PsiBlast_CBE 62.7839%-111 - C1 -3R8V 5.4 CDK2_HUMAN
68 PsiBlast_CBE 62.7539%-113 - C1 -3RM7 5.1 CDK2_HUMAN
56 PsiBlast_CBE 62.7139%-106 - C1 -3SQQ 5.9 CDK2_HUMAN
97 PsiBlast_CBE 62.6339%-108 - C1 -3R6X 5.4 CDK2_HUMAN
55 PsiBlast_CBE 62.5239%-110 - C1 -4EZ3 4.3 CDK2_HUMAN
91 PsiBlast_CBE 62.5039%-109 - C1 -3R7V 4.6 CDK2_HUMAN
98 PsiBlast_CBE 62.4839%-109 - C1 -3R28 5.8 CDK2_HUMAN
88 PsiBlast_CBE 62.2439%-111 - C1 -3R8L 4.6 CDK2_HUMAN
95 PsiBlast_CBE 62.1639%-110 - C1 -3R73 5.8 CDK2_HUMAN
44 PsiBlast_CBE 62.1339%-103 - C1 -2BKZ 4.9 CDK2_HUMAN
65 PsiBlast_CBE 62.0839%-108 - C1 -3ROY 5.5 CDK2_HUMAN
48 PsiBlast_CBE 62.0840%-118 - C1 -3O0G 6.4 CDK5_HUMAN
79 PsiBlast_CBE 62.0739%-109 - C1 -3R9O 5.6 CDK2_HUMAN
87 PsiBlast_CBE 62.0139%-106 - C1 -3R8M 3.7 CDK2_HUMAN
81 PsiBlast_CBE 61.8539%-112 - C1 -3R9H 5.2 CDK2_HUMAN
82 PsiBlast_CBE 61.7839%-106 - C1 -3R9D 5.7 CDK2_HUMAN
30 PsiBlast_CBE 61.7440%-123 - C1 -1V0P 7.1 CDC2H_PLAFK
76 PsiBlast_CBE 61.6839%-111 - C1 -3RAK 5.9 CDK2_HUMAN
62 PsiBlast_CBE 61.6839%-109 - C1 -3RPV 6.0 CDK2_HUMAN
74 PsiBlast_CBE 61.6739%-113 - C1 -3RJC 5.9 CDK2_HUMAN
57 PsiBlast_CBE 61.4739%-111 - C1 -3S1H 6.1 CDK2_HUMAN
67 PsiBlast_CBE 61.4139%-111 - C1 -3RMF 7.3 CDK2_HUMAN
26 PsiBlast_CBE 61.3541%-106 - C1 -4AU8 4.9 CDK5_HUMAN
123 HHSearch 61.2936%-113 - C1 -4F6U 9.1 CDK8_HUMAN
53 PsiBlast_CBE 61.0939%-107 - C1 -4GCJ 5.7 CDK2_HUMAN
61 PsiBlast_CBE 61.0439%-112 - C1 -3RPY 4.0 CDK2_HUMAN
42 PsiBlast_CBE 60.9539%-105 - C1 -2BPM 5.8 CDK2_HUMAN
60 PsiBlast_CBE 60.9039%-112 - C1 -3RZB 4.5 CDK2_HUMAN
73 PsiBlast_CBE 60.8939%-110 - C1 -3RK5 5.6 CDK2_HUMAN
71 PsiBlast_CBE 60.8739%-108 - C1 -3RK9 4.9 CDK2_HUMAN
47 PsiBlast_CBE 60.8639%-102 - C1 -1VYW 6.7 CDK2_HUMAN
36 PsiBlast_CBE 60.8139%-107 - C1 -2WIP 7.3 CDK2_HUMAN
66 PsiBlast_CBE 60.7939%-106 - C1 -3RNI 5.1 CDK2_HUMAN
37 PsiBlast_CBE 60.7439%-106 - C1 -2WIP 7.3 CDK2_HUMAN
75 PsiBlast_CBE 60.6739%-111 - C1 -3RAL 6.2 CDK2_HUMAN
43 PsiBlast_CBE 60.6539%-101 - C1 -2BPM 5.9 CDK2_HUMAN
45 PsiBlast_CBE 60.6039%-102 - C1 -2BKZ 5.3 CDK2_HUMAN
32 PsiBlast_CBE 60.5939%-105 - C1 -2WXV 7.1 CDK2_HUMAN
70 PsiBlast_CBE 60.5539%-110 - C1 -3RKB 4.9 CDK2_HUMAN
41 PsiBlast_CBE 60.5339%-101 - C1 -2C4G 5.6 CDK2_HUMAN
72 PsiBlast_CBE 60.5239%-110 - C1 -3RK7 5.8 CDK2_HUMAN
40 PsiBlast_CBE 60.3339%-104 - C1 -2C4G 5.5 CDK2_HUMAN
35 PsiBlast_CBE 60.2939%-101 - C1 -2WPA 6.2 CDK2_HUMAN
39 PsiBlast_CBE 60.2439%-101 - C1 -2WIH 8.8 CDK2_HUMAN
34 PsiBlast_CBE 60.1139%-105 - C1 -2WPA 6.1 CDK2_HUMAN
69 PsiBlast_CBE 59.9939%-103 - C1 -3RM6 5.7 CDK2_HUMAN
46 PsiBlast_CBE 59.7939%-107 - C1 -1VYW 6.4 CDK2_HUMAN
54 PsiBlast_CBE 59.5039%-100 - C1 -4EZ7 8.9 CDK2_HUMAN
38 PsiBlast_CBE 59.2739%-106 - C1 -2WIH 8.3 CDK2_HUMAN
33 PsiBlast_CBE 59.2339%-101 - C1 -2WXV 7.8 CDK2_HUMAN
127 HHSearch 58.2836%-114 - C1 -4BGQ 7.5 CDKL5_HUMAN
125 HHSearch 55.3535%-110 - C1 -1CM8 5.0 MK12_HUMAN
128 HHSearch 49.5533%-110 - C1 -2FST - MK14_HUMAN
129 HHSearch 20.2841% 11 * C1 *4EK4 3.2 CDK2_HUMAN