@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 085_tII_WHEAT: (2014-05-01 )
ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 95.01100%-123 - C4 -1N89 5.9 NLT2G_WHEAT
2 HHSearch 78.1860%-139 - C4 -1L6H - NLTPX_ORYSJ -
26 SP3 77.9459%-139 - C4 -1L6H - NLTPX_ORYSJ -
16 Fugue 77.9459%-139 - C4 -1L6H - NLTPX_ORYSJ -
17 Fugue 67.9931%-120 - C4 -2RKN - DIRL1_ARATH -
35 SP3 66.5722%-154 - C4 -1S6D - 2SS8_HELAN -
3 HHSearch 61.4130%-109 - C4 -2RKN - DIRL1_ARATH -
8 HHSearch 60.3128% -88 - C4 -1AFH - NLTP_MAIZE -
27 SP3 60.1525% -85 * C4 *1FK5 - NLTP_MAIZE -
9 HHSearch 59.6335%-103 - C4 -1T12 - NLTP1_TOBAC -
18 Fugue 57.4730% -82 - C4 -1BWO - NLTP1_WHEAT -
6 HHSearch 54.0328% -86 - C4 -2ALG - NLTP1_PRUPE -
5 HHSearch 51.3923% -75 - C4 -1SIY - NLTP1_VIGRR -
11 HHSearch 50.6723%-101 - C4 -1HYP - HPSE_SOYBN -
4 HHSearch 49.1328% -54 - C4 -1BWO - NLTP1_WHEAT -
19 Fugue 48.7529% -81 * C2 *1CWV - -
21 Fugue 48.1321%-109 * C6 *2KSS - CARS_MYXXA -
24 Fugue 44.7620% -78 - C4 -1Q1V - DEK_HUMAN -
20 Fugue 43.7214%-100 - C1 -1DIK - ? -
25 Fugue 43.4913% -93 - C6 -1GCQ - -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
41 92.74100%-126 - C- -M041 - -
40 91.89100%-114 - C- -M040 - -
42 91.19100%-116 - C- -M042 - -
43 89.12100%-117 - C- -M043 - -