@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 126_tII_ORYSA: (2014-05-01 )
AVVPPSRCNPTLLTPCAGPALFGGPVPPACCAQLRAQAACLCAYARSPNYGSYIRSPNARRLFAVCGLPMPQCS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 92.7246%-150 - C6 -1N89 5.3 NLT2G_WHEAT
15 Fugue 84.2143%-131 - C6 -1L6H - NLTPX_ORYSJ -
2 HHSearch 84.2143%-131 - C6 -1L6H - NLTPX_ORYSJ -
25 SP3 82.7740%-131 - C6 -1L6H - NLTPX_ORYSJ -
16 Fugue 73.9934%-143 - C6 -2RKN - DIRL1_ARATH -
5 HHSearch 73.3340%-120 - C6 -2ALG - NLTP1_PRUPE -
8 HHSearch 71.7127%-138 - C6 -1AFH - NLTP_MAIZE -
3 HHSearch 71.6131%-146 - C6 -2RKN - DIRL1_ARATH -
7 HHSearch 70.5734%-130 - C6 -1SIY - NLTP1_VIGRR -
26 SP3 70.3222%-125 * C6 *1FK5 - NLTP_MAIZE -
4 HHSearch 63.9227%-134 - C6 -1BWO - NLTP1_WHEAT -
9 HHSearch 63.8932%-108 - C6 -1T12 - NLTP1_TOBAC -
27 SP3 63.0616%-133 - C6 -1KNG - CYCY_BRADU -
10 HHSearch 61.3924%-136 - C6 -1HYP - HPSE_SOYBN -
30 SP3 58.0613%-142 - C6 -1LU4 - -
19 Fugue 49.6818%-103 - C6 -1S6D - 2SS8_HELAN -
28 SP3 48.6612%-120 - C6 -1PS6 - PDXA_ECOLI -
21 Fugue 45.9118%-102 - C4 -1MOL - MONB_DIOCU -
20 Fugue 41.9719%-113 * C4 *2LU7 - -
29 SP3 40.5910%-113 - C6 -1U78 - TC3A_CAEEL -


User Run . : Multi Template Modeling Result:

(2 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
37 98.13100%-143 - C- -M037 - -
39 97.40100%-162 - C- -M039 - -