@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 151_tIV_ARATH: (2014-05-02 )
IDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPELASALPKQCGLANAPTC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]
1 Fugue 99.94100%-109 - C3 -2RKN 6.5 DIRL1_ARATH
11 HHSearch 97.00100%-107 - C3 -2RKN - DIRL1_ARATH -
36 SP3 59.6823% -80 - C3 -1BEA - ? -
34 SP3 57.7021%-103 * C3 *1HSS - IAA1_WHEAT -
12 HHSearch 52.6230% -84 - C3 -1N89 - NLT2G_WHEAT -
18 HHSearch 52.5728% -70 - C3 -1T12 - NLTP1_TOBAC -
26 HHSearch 52.4824% -75 - C3 -1BEA - ITRF_MAIZE -
19 HHSearch 51.3533% -78 - C3 -2ALG - NLTP1_PRUPE -
17 HHSearch 51.2733% -61 - C3 -1SIY - NLTP1_VIGRR -
27 HHSearch 50.1925% -80 - C3 -1SM7 - ? -
38 SP3 49.8918% -94 - C3 -1HYP - ? -
24 HHSearch 48.8826%-101 - C3 -3OB4 - ? -
32 SP3 48.6422% -62 - C3 -1FK5 - NLTP_MAIZE -
23 HHSearch 48.6226% -71 - C3 -1HSS - IAA1_WHEAT -
14 HHSearch 47.2725% -47 - C3 -1AFH - NLTP_MAIZE -
16 HHSearch 47.1222% -71 - C3 -1BWO - NLTP1_WHEAT -
8 Fugue 47.0428% -64 - C3 -1S6D - 2SS8_HELAN -
39 SP3 46.4717%-102 - C3 -1K6K - CLPA_ECOLI -
29 HHSearch 43.6324% -62 - C3 -1B1U - IAAT_ELECO -
13 HHSearch 43.2928% -73 - C3 -1L6H - NLTPX_ORYSJ -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]



LP3_A_6(2RKN)
DIRL1_ARATH
[Raw transfer]
49 94.21100%-113 - C- -M049 - -
45 94.21100%-113 - C- -M045 - -
42 92.58100%-122 - C- -M042 - -