@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 496_tIV_RICCO: (2014-05-09 )
QSICNVPISGLMACKPAVTPPNPSAPTSACCSALTHADMRCLCSYKNSNLLPSLGIDPNLALQLPPKCNLPRPNC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
11 HHSearch 98.5948%-152 - C1 -2RKN - DIRL1_ARATH -
1 Fugue 98.5848%-152 - C1 -2RKN 5.5 DIRL1_ARATH
35 SP3 71.3826%-130 - C1 -1HSS - IAA1_WHEAT -
19 HHSearch 69.8935%-127 - C1 -2ALG - NLTP1_PRUPE -
25 HHSearch 67.1128%-105 - C1 -1BEA - ITRF_MAIZE -
18 HHSearch 59.9026%-112 - C1 -1T12 - NLTP1_TOBAC -
16 HHSearch 59.6430%-108 - C1 -1SIY - NLTP1_VIGRR -
28 HHSearch 59.3123% -86 - C1 -1B1U - IAAT_ELECO -
22 HHSearch 58.8928% -88 * C1 *1HSS - IAA1_WHEAT -
32 SP3 58.6124% -96 - C1 -1FK5 - NLTP_MAIZE -
14 HHSearch 56.9922%-104 - C1 -1BWO - NLTP1_WHEAT -
12 HHSearch 55.3427%-109 - C1 -1N89 - NLT2G_WHEAT -
2 Fugue 54.7027%-100 - C1 -1L6H - NLTPX_ORYSJ -
36 SP3 54.4617%-125 - C1 -1HYP - ? -
26 HHSearch 53.6525% -85 - C1 -2LVF - ? -
13 HHSearch 50.9527% -96 - C1 -1L6H - NLTPX_ORYSJ -
15 HHSearch 50.5725% -83 - C1 -1AFH - NLTP_MAIZE -
20 HHSearch 50.4924% -95 - C1 -1S6D - 2SS8_HELAN -
33 SP3 49.8824%-106 - C1 -1L6H - NLTPX_ORYSJ -
5 Fugue 49.5525% -98 - C1 -1S6D - 2SS8_HELAN -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LP3_A_5(2RKN)
DIRL1_ARATH
[Raw transfer]
46 95.08100%-160 - C- -M046 - -
44 92.78100%-159 - C- -M044 - -
42 92.78100%-159 - C- -M042 - -