@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0195: (2015-11-29 )
MSLSDARSISYMSDIISIASDHAGYELKSEIKSYLETLGCKVLDRGCTAEQKCVDYPDYAVKIAEDIINKKADYGILICGTGLGMSIVANRFKGIHAVLCNSVEITKLAREHGNANVLCLGARFTASGLAKDIVKQFLETEFSKESRHKRRLDKLSNIASFSKRKKVQTYNEDEVSKFAKMVGEWWDENGKFKPLHMMNPVRVSYIIEKIKELKKCDLKKLSLLDVGCGGGILSESIARVGINVLGIDVCEENIKVAQSHAKKVGLNIEYTHTSIEELSNNQKYDVVLLMEVVEHVDNLELFIKKAIELLKPEGLIFISTINRTFKSFFLAIIGAEYILNWLPKGTHNWNKFLKPSEIANHLREGNVTLQDMAGMEYNIIKSEWNLTKGVDVNYILCGVMNS

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

R52_D_8(3K7S)
?
[Raw transfer]




R52_C_7(3K7S)
?
[Raw transfer]




R5P_A_3(3HEE)
?
[Raw transfer]




R52_B_6(3K7S)
?
[Raw transfer]




RES_B_4(3K8C)
?
[Raw transfer]




R5P_B_4(3HEE)
?
[Raw transfer]




R52_A_5(3K7S)
?
[Raw transfer]




RES_A_3(3K8C)
?
[Raw transfer]




RB5_A_3(3PH3)
?
[Raw transfer]




RB5_A_3(3PH3)
?
[Raw transfer]




RB5_B_4(3PH3)
?
[Raw transfer]




AOS_A_3(3PH4)
?
[Raw transfer]




GOL_B_4(3HE8)
?
[Raw transfer]




AOS_B_4(3PH4)
?
[Raw transfer]




GOL_A_3(3HE8)
?
[Raw transfer]




GOL_A_3(3HE8)
?
[Raw transfer]




1 PsiBlast_PDB 90.9142%-122 - C1 -4KDC - UBIG_ECOLI -
2 PsiBlast_PDB 83.2836%-110 - C1 -4KDR - UBIG_ECOLI -
3 PsiBlast_PDB 79.5945%-112 - C3 -4EM8 - ? -
13 PsiBlast_PDB 79.2839%-104 - C3 -1NN4 - RPIB_ECOLI -
116 HHSearch 78.1944%-114 - C3 -3HE8 2.9 ?
115 HHSearch 78.0342%-116 * C3 *3PH3 2.2 ?
21 PsiBlast_CBE 77.7845%-113 - C3 -3PH4 2.8 ?
5 PsiBlast_PDB 77.7745%-114 - C3 -3PH3 2.2 ?
19 PsiBlast_PDB 77.4639%-104 - C3 -2VVR - RPIB_ECOLI -
23 PsiBlast_CBE 77.3345%-114 - C3 -3HEE 2.5 ?
24 PsiBlast_CBE 77.0145%-114 - C3 -3HE8 3.2 ?
4 PsiBlast_PDB 76.9245%-114 - C3 -3PH4 3.1 ?
6 PsiBlast_PDB 76.7045%-114 - C3 -3HE8 2.9 ?
22 PsiBlast_CBE 76.6945%-113 - C3 -3PH3 3.0 ?
113 HHSearch 76.5138%-105 - C3 -2VVR - RPIB_ECOLI -
51 PsiBlast_CBE 76.4536%-112 - C3 -2BET - RPIB_MYCTU -
63 PsiBlast_CBE 76.0036%-107 - C3 -1USL - RPIB_MYCTU -
44 PsiBlast_CBE 76.0036%-110 - C3 -2VVP - RPIB_MYCTU -
7 PsiBlast_PDB 75.9445%-114 - C3 -3HEE 3.0 ?
49 PsiBlast_CBE 75.8436%-110 - C3 -2BET - RPIB_MYCTU -
9 PsiBlast_PDB 73.4337%-105 - C3 -3K7S 2.4 ?
26 PsiBlast_CBE 73.2237%-105 - C3 -3K7S 3.4 ?
10 PsiBlast_PDB 72.6537%-107 - C3 -3K8C 3.4 ?
25 PsiBlast_CBE 72.4637%-108 - C3 -3K8C 3.3 ?
27 PsiBlast_CBE 72.4437%-103 - C3 -3K7S 3.5 ?
28 PsiBlast_CBE 72.2937%-106 - C3 -3K7S 3.0 ?