@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0301: (2015-12-14 )
MLNRIIEHMNAHHVEDMKGLLKKFGQVHHAENVAFKSVDPQGIVIGYNNNQTLRIEFNHEVKDPKDYKNAIIELCQSVEKTHDLKGVEEEVKAFRKDFDSVCLATLHPNGHVVCSYAPLMTDGKQYYIYVSEVAEHFAGLKNNPHNVEVMFLEDESKAKSAILRKRLRYKTNARFIERGAEFDKAFDSFIEKTGGAGGIKTIRTMQDFHLIALDFKEGRFVKGFGQAYDILGDKIAYVGDKGNPHNFAHKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEM_A_2(3SWJ)
?
[Raw transfer]




HEM_A_2(3SWJ)
?
[Raw transfer]




EDO_A_4(1VL7)
?
[Raw transfer]




EDO_A_4(1VL7)
?
[Raw transfer]




EDO_B_3(1VL7)
?
[Raw transfer]




EDO_A_4(1VL7)
?
[Raw transfer]




1 PsiBlast_PDB 99.1794%-114 - C5 -3GAS - ? -
24 HHSearch 99.0696%-114 - C5 -3GAS - ? -
46 Fugue 91.3488% -99 - C5 -3GAS - ? -
25 HHSearch 85.2554%-115 - C5 -3SWJ 9.2 ?
2 PsiBlast_PDB 84.1954%-112 - C5 -3SWJ 9.2 ?
4 PsiBlast_PDB 62.6436%-113 - C5 -1VL7 2.8 ?
26 HHSearch 61.9037%-108 - C5 -1VL7 3.1 ?
3 PsiBlast_PDB 61.8336%-115 - C5 -3TGV - ? -
47 Fugue 61.6037%-114 * C5 *1VL7 3.1 ?
23 PsiBlast_CBE 61.5436%-112 - C5 -1VL7 2.9 ?
21 PsiBlast_CBE 60.8036%-112 - C5 -3TGV - ? -
22 PsiBlast_CBE 60.7836%-111 - C5 -3TGV - ? -
28 HHSearch 60.1436%-105 - C5 -3TGV - ? -
20 PsiBlast_CBE 59.8336%-112 - C5 -3TGV - ? -
32 HHSearch 51.0410%-105 - C5 -2RE7 - ? -
31 HHSearch 50.2819% -77 - C5 -2ARZ - ? -
35 HHSearch 49.0514% -89 - C5 -2IAB - ? -
34 HHSearch 46.309% -99 - C5 -2I02 - ? -
33 HHSearch 45.5613% -95 - C5 -2HQ7 - ? -
44 HHSearch 44.5610% -90 - C5 -2FG9 - ? -