@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0506: (2016-03-16 )
MKALKLYGKRDLRYEEADMPTIEEPDDVILKVKTVGICGSDISRYSKLGPYVPGMVWGHEFSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCRKLTVIGARHPGAYAEYIKLPAENVVKIPNELDYEAAALVEPSAVVVHGFYHTKLQAGDDVVVVGSGNIGLLAIQWAKVFGARRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVAAHTDGLNADLVVEAAGSPITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSELTVWGSWNAISAPFPGKEWQTTIHFLANKQINIEPMITHRLSLAEGPEVFERIYERNEFFGKVLFFPE

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MES_A_7(2DQ4)
TDH_THET8
[Raw transfer]




MES_A_7(2DQ4)
TDH_THET8
[Raw transfer]




TRS_B_9(4UEK)
?
[Raw transfer]




GOL_B_9(4UEJ)
?
[Raw transfer]




15 PsiBlast_PDB 87.3432%-106 - C1 -3PII - ADH3_GEOSE -
23 PsiBlast_CBE 85.5937% -95 - C1 -4UEJ 3.4 ?
4 PsiBlast_PDB 85.4237% -97 - C1 -4UEO - ? -
38 PsiBlast_CBE 84.7832%-107 - C1 -3PII - ADH3_GEOSE -
36 PsiBlast_CBE 84.7232%-106 - C1 -1RJW - ADH3_GEOSE -
14 PsiBlast_PDB 84.5332%-103 - C1 -1RJW - ADH3_GEOSE -
2 PsiBlast_PDB 84.3637% -95 - C1 -4UEJ - ? -
1 PsiBlast_PDB 84.3537% -97 - C1 -4A2C - GATD_ECOLI -
37 PsiBlast_CBE 83.9732%-105 - C1 -3PII - ADH3_GEOSE -
9 PsiBlast_PDB 83.8633%-103 - C1 -2DFV - TDH_PYRHO -
35 PsiBlast_CBE 83.8032%-105 - C1 -1RJW - ADH3_GEOSE -
34 PsiBlast_CBE 83.4032%-105 - C1 -1RJW - ADH3_GEOSE -
22 PsiBlast_CBE 83.0537% -94 - C1 -4UEK 3.6 ?
24 PsiBlast_CBE 83.0237% -96 - C1 -4A2C - GATD_ECOLI -
5 PsiBlast_PDB 82.5535% -96 - C1 -4EJ6 - ? -
3 PsiBlast_PDB 81.7137% -96 - C1 -4UEK - ? -
39 PsiBlast_CBE 81.4532%-105 - C1 -3PII - ADH3_GEOSE -
6 PsiBlast_PDB 81.4235% -97 - C1 -4EJM - ? -
19 PsiBlast_PDB 81.1328%-107 - C1 -1E3J - ? -
21 PsiBlast_CBE 80.6937% -95 - C1 -4UEO - ? -
75 HHSearch 73.3430% -90 - C1 -2DQ4 2.1 TDH_THET8
17 PsiBlast_PDB 64.7730% -96 - C1 -2DQ4 2.2 TDH_THET8