@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0579: (2016-03-16 )
LANIEYEIIEEIGVLSENARGWRKELNKVSWNGRPPKYDIRDWSEDHEKMGKGITLTDEEAEVLKKLLD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DT_A_4(4G06)
?
[Raw transfer]



CIT_A_4(3OBH)
?
[Raw transfer]



CIT_A_4(3OBH)
?
[Raw transfer]



DT_A_3(4G06)
?
[Raw transfer]



NACID_C_3(2LTT)
?
[Raw transfer]
-
NACID_C_3(2LTT)
?
[Raw transfer]
-
12 HHSearch 76.9767% -14 - C7 -3PM7 - ? -
13 HHSearch 75.0869% -6 - C7 -2LTD - ? -
1 PsiBlast_PDB 73.2169% -12 - C7 -3PM7 - ? -
2 PsiBlast_PDB 71.9172% -5 - C7 -2LTD - ? -
3 PsiBlast_PDB 69.3072% -9 - C7 -2LTT 7.7 ?
10 PsiBlast_CBE 66.7572% -11 - C7 -2LTT 7.9 ?
5 PsiBlast_PDB 64.5256% 17 - C7 -3OBH 3.4 ?
11 HHSearch 64.4452% -20 - C7 -2L3A - ? -
36 Fugue 64.0451% 7 - C7 -3OBH 2.3 ?
6 PsiBlast_PDB 63.4356% 4 - C7 -4G06 3.7 ?
4 PsiBlast_PDB 60.1656% -9 - C7 -2L3A - ? -
40 Fugue 47.7620% -27 - C7 -2BLF - ? -
33 HHSearch 46.3431% -55 * C7 *2ZRR - ? -
41 Fugue 38.7526% 32 - C3 -1O75 - TA47_TREPA -
34 HHSearch 38.0444% -34 - C7 -2K19 - ? -
14 HHSearch 36.4628% 23 - C7 -1PCF - TCP4_HUMAN -
18 HHSearch 35.3417% -43 - C7 -1VSQ - ? -
20 HHSearch 34.8713% -42 - C7 -1BLE - PTFB_BACSU -
25 HHSearch 34.4729% -61 - C7 -2Z3X - SSPC_BACSU -
27 HHSearch 33.2341% -4 * C8 *3ZDS - HGD_PSEPK -