@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1138: (2016-03-21 )
MAENTKNENITNILTQKLIDTRTVLIYGEINQELAEDVSKQLLLLESISNDPITIFINSQGGHVEAGDTIHDMIKFIKPTVKVVGTGWVASAGITIYLAAEKENRFSLPNTRYMIHQPAGGVQGQSTEIEIEAKEIIRMRERINRLIAEATGQSYEQISKDTDRNFWLSVNEAKDYGIVNEIIENRDGLK

Atome Classification :

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DFP_G_14(3TT7)
CLPP_BACSU
[Raw transfer]




DFP_B_9(3TT7)
CLPP_BACSU
[Raw transfer]




DFP_C_10(3TT7)
CLPP_BACSU
[Raw transfer]




DFP_D_11(3TT7)
CLPP_BACSU
[Raw transfer]




DFP_A_8(3TT7)
CLPP_BACSU
[Raw transfer]




DFP_F_13(3TT7)
CLPP_BACSU
[Raw transfer]




DFP_E_12(3TT7)
CLPP_BACSU
[Raw transfer]




CHAIN_W_18(2ZL4)
CLPP_HELPY
[Raw transfer]

-

CHAIN_X_20(2ZL4)
CLPP_HELPY
[Raw transfer]

-

CHAIN_T_12(2ZL4)
CLPP_HELPY
[Raw transfer]

-

CHAIN_Q_17(2ZL2)
CLPP_HELPY
[Raw transfer]

-

CHAIN_Q_6(2ZL4)
CLPP_HELPY
[Raw transfer]

-

CHAIN_Y_22(2ZL4)
CLPP_HELPY
[Raw transfer]

-

CHAIN_S_19(2ZL2)
CLPP_HELPY
[Raw transfer]

-

CHAIN_U_14(2ZL4)
CLPP_HELPY
[Raw transfer]

-

CHAIN_V_16(2ZL4)
CLPP_HELPY
[Raw transfer]

-

CHAIN_X_24(2ZL2)
CLPP_HELPY
[Raw transfer]

-

CHAIN_R_18(2ZL2)
CLPP_HELPY
[Raw transfer]

-

CHAIN_O_15(2ZL2)
CLPP_HELPY
[Raw transfer]

-

CHAIN_U_21(2ZL2)
CLPP_HELPY
[Raw transfer]

-

CHAIN_S_10(2ZL4)
CLPP_HELPY
[Raw transfer]

-

CHAIN_T_20(2ZL2)
CLPP_HELPY
[Raw transfer]

-

CHAIN_W_23(2ZL2)
CLPP_HELPY
[Raw transfer]

-

CHAIN_V_22(2ZL2)
CLPP_HELPY
[Raw transfer]

-

23 PsiBlast_CBE 97.59100%-120 - C4 -4RYF - ? -
24 PsiBlast_CBE 97.44100%-120 - C4 -4RYF - ? -
22 PsiBlast_CBE 97.41100%-120 - C4 -4RYF - ? -
26 PsiBlast_CBE 97.35100%-120 - C4 -4RYF - ? -
21 PsiBlast_CBE 97.33100%-120 - C4 -4RYF - ? -
1 PsiBlast_PDB 97.12100%-120 - C4 -4RYF - ? -
25 PsiBlast_CBE 97.03100%-120 - C4 -4RYF - ? -
2 PsiBlast_PDB 94.0899%-122 - C4 -4JCR - ? -
103 PsiBlast_CBE 80.6442%-121 - C4 -3TT7 4.1 CLPP_BACSU
121 PsiBlast_CBE 80.1742%-120 - C4 -3KTK - CLPP_BACSU -
6 PsiBlast_PDB 80.0342%-119 - C4 -2ZL4 - CLPP_HELPY -
111 PsiBlast_CBE 79.9042%-122 - C4 -3KTK - CLPP_BACSU -
69 PsiBlast_CBE 79.8043%-124 - C4 -2FZS - CLPP_ECOLI -
104 PsiBlast_CBE 79.7842%-118 - C4 -3TT7 2.9 CLPP_BACSU
116 PsiBlast_CBE 79.7542%-120 - C4 -3KTK - CLPP_BACSU -
49 PsiBlast_CBE 79.7542%-118 - C4 -2ZL4 - CLPP_HELPY -
45 PsiBlast_CBE 79.6842%-119 - C4 -2ZL4 4.1 CLPP_HELPY
71 PsiBlast_CBE 79.5443%-121 - C4 -2FZS - CLPP_ECOLI -
110 PsiBlast_CBE 79.4842%-118 - C4 -3KTK - CLPP_BACSU -
48 PsiBlast_CBE 79.4842%-117 - C4 -2ZL4 3.9 CLPP_HELPY
107 PsiBlast_CBE 79.4242%-118 - C4 -3TT7 3.2 CLPP_BACSU
102 PsiBlast_CBE 79.3142%-120 - C4 -3TT7 4.3 CLPP_BACSU
42 PsiBlast_CBE 79.0442%-120 - C4 -2ZL4 3.8 CLPP_HELPY
106 PsiBlast_CBE 79.0342%-120 - C4 -3TT7 2.9 CLPP_BACSU
105 PsiBlast_CBE 79.0042%-117 - C4 -3TT7 4.2 CLPP_BACSU
43 PsiBlast_CBE 78.9542%-121 - C4 -2ZL4 4.1 CLPP_HELPY
41 PsiBlast_CBE 78.8842%-119 - C4 -2ZL4 2.9 CLPP_HELPY
35 PsiBlast_CBE 78.7342%-121 - C4 -2ZL2 3.5 CLPP_HELPY
108 PsiBlast_CBE 78.7242%-118 - C4 -3TT7 2.9 CLPP_BACSU
40 PsiBlast_CBE 78.4842%-117 - C4 -2ZL4 3.8 CLPP_HELPY
32 PsiBlast_CBE 78.4042%-122 - C4 -2ZL2 3.6 CLPP_HELPY
30 PsiBlast_CBE 78.3242%-120 - C4 -2ZL2 6.2 CLPP_HELPY
4 PsiBlast_PDB 78.3242%-117 - C4 -2ZL2 3.6 CLPP_HELPY
46 PsiBlast_CBE 77.9642%-113 - C4 -2ZL4 4.2 CLPP_HELPY
44 PsiBlast_CBE 77.7042%-114 - C4 -2ZL4 3.9 CLPP_HELPY
29 PsiBlast_CBE 77.5942%-115 - C4 -2ZL2 4.5 CLPP_HELPY
27 PsiBlast_CBE 77.3342%-121 - C4 -2ZL2 3.2 CLPP_HELPY
31 PsiBlast_CBE 76.9742%-119 - C4 -2ZL2 3.8 CLPP_HELPY
28 PsiBlast_CBE 76.7342%-118 - C4 -2ZL2 3.8 CLPP_HELPY
33 PsiBlast_CBE 76.4942%-117 - C4 -2ZL2 3.1 CLPP_HELPY