@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1435: (2016-03-24 )
MDLGKVITAMVTPIHPEKDKVCKKRIHHLVNHLIKNGSDGLVIAGTTGESPTLSHDEKIKLFRQVIETNDGRAKLIAGTGSNNTAETIAFTKEVATLGGMDAVLIVAPYYNKPNQDGLYAHFAAVAEASDLPVVIYNIPGRSVVNIEPETIIRLAKLPNIVGVKESSGNLDNISKIIAETSDDFQVYSGDDSLTLPILAVGGNGVISVASHIVGNEMQEMIQAFERGEVQKAAQIHRELLPLMNGLFSVPNPAPTKYLLNQQGISVGPVRLPLVDLNAEQGTKLQAILEGLSK

Atome Classification :

(48 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_14(3I7R)
DAPA_ECOLI
[Raw transfer]




PYR_B_20(3I7S)
DAPA_ECOLI
[Raw transfer]




GOL_A_4(4ICN)
?
[Raw transfer]




GOL_B_8(3TAK)
?
[Raw transfer]




PYR_A_8(3I7S)
DAPA_ECOLI
[Raw transfer]




GOL_A_3(3TAK)
?
[Raw transfer]




GOL_A_5(3VFL)
?
[Raw transfer]




GOL_A_3(3TAK)
?
[Raw transfer]




GOL_B_8(4ICN)
?
[Raw transfer]




GOL_A_11(3FLU)
DAPA_NEIMB
[Raw transfer]




GOL_A_3(3DI0)
DAPA_STAAC
[Raw transfer]




GOL_A_9(3DAQ)
DAPA_STAAR
[Raw transfer]




GOL_B_4(3DI0)
DAPA_STAAC
[Raw transfer]




OXM_B_6(3UQN)
?
[Raw transfer]




OXM_A_4(3UQN)
?
[Raw transfer]




GOL_B_11(3VFL)
?
[Raw transfer]




MES_A_8(3VFL)
?
[Raw transfer]




GOL_D_11(4I7U)
DAPA_AGRFC
[Raw transfer]




3OH_B_4(3S8H)
DAPA_PSEAE
[Raw transfer]




GOL_B_6(4I7U)
DAPA_AGRFC
[Raw transfer]




MES_B_12(3VFL)
?
[Raw transfer]




2KT_B_4(3TDF)
?
[Raw transfer]




PYR_B_4(3DI1)
DAPA_STAAC
[Raw transfer]




GOL_B_8(3PUD)
?
[Raw transfer]




3OH_A_3(3S8H)
DAPA_PSEAE
[Raw transfer]




PYR_A_3(3DI1)
DAPA_STAAC
[Raw transfer]




2KT_A_3(3TDF)
?
[Raw transfer]




PYR_A_3(3RK8)
?
[Raw transfer]




PYR_B_11(3RK8)
?
[Raw transfer]




LYS_B_5(3PUE)
?
[Raw transfer]




EDO_A_6(3SI9)
DAPA_BARHE
[Raw transfer]




LYS_B_6(3PUL)
?
[Raw transfer]




113 HHSearch 97.1849%-100 - C6 -1XKY - ? -
1 PsiBlast_PDB 96.8349% -96 - C6 -1XKY - ? -
21 PsiBlast_CBE 96.3649% -94 - C6 -1XKY - ? -
22 PsiBlast_CBE 95.9249% -93 - C6 -1XKY - ? -
23 PsiBlast_CBE 95.8549% -95 - C6 -1XKY - ? -
2 PsiBlast_PDB 94.7149% -93 - C6 -1XL9 - ? -
3 PsiBlast_PDB 93.5750%-101 - C6 -3VFL 3.6 ?
24 PsiBlast_CBE 92.9150%-100 - C6 -3VFL 3.0 ?
5 PsiBlast_PDB 91.4344% -99 - C6 -2YXG - DAPA_METJA -
130 HHSearch 90.3044% -94 - C6 -2YXG - DAPA_METJA -
4 PsiBlast_PDB 90.2844% -83 - C6 -1XXX - DAPA_MYCTU -
27 PsiBlast_CBE 90.2544% -86 - C6 -1XXX - DAPA_MYCTU -
31 PsiBlast_CBE 89.9644% -84 - C6 -1XXX - DAPA_MYCTU -
29 PsiBlast_CBE 89.5844% -86 - C6 -1XXX - DAPA_MYCTU -
28 PsiBlast_CBE 89.4644% -84 - C6 -1XXX - DAPA_MYCTU -
26 PsiBlast_CBE 89.4444% -83 - C6 -1XXX - DAPA_MYCTU -
30 PsiBlast_CBE 89.4344% -84 - C6 -1XXX - DAPA_MYCTU -
122 HHSearch 89.0941% -92 - C6 -2RFG - ? -
127 HHSearch 88.8041% -94 - C6 -2EHH - DAPA_AQUAE -
102 Fugue 88.5838% -92 - C6 -1DHP - DAPA_ECOLI -
118 HHSearch 88.0440% -87 - C6 -3FLU 2.4 DAPA_NEIMB
36 PsiBlast_CBE 87.3340% -93 - C6 -3I7S 2.9 DAPA_ECOLI
12 PsiBlast_PDB 87.2040% -94 - C6 -3I7S 3.1 DAPA_ECOLI
11 PsiBlast_PDB 86.1440% -91 - C6 -3I7R Error DAPA_ECOLI
62 PsiBlast_CBE 84.3040% -91 - C6 -3S8H 3.5 DAPA_PSEAE
120 HHSearch 84.0737% -89 - C6 -3TAK 2.1 ?
71 PsiBlast_CBE 83.8440% -97 - C6 -4ICN 2.9 ?
125 HHSearch 83.6336% -86 - C6 -3SI9 2.2 DAPA_BARHE
63 PsiBlast_CBE 83.5540% -93 - C6 -3S8H 2.5 DAPA_PSEAE
70 PsiBlast_CBE 83.5440% -96 - C6 -4ICN 3.4 ?
86 PsiBlast_CBE 83.2339% -89 - C6 -3PUL 2.7 ?
78 PsiBlast_CBE 83.2239% -89 - C6 -3TDF 2.9 ?
74 PsiBlast_CBE 82.6839% -90 - C6 -3UQN 3.2 ?
85 PsiBlast_CBE 82.6539% -91 - C6 -3RK8 2.4 ?
82 PsiBlast_CBE 82.5539% -90 - C6 -3TAK 2.2 ?
79 PsiBlast_CBE 82.5239% -88 - C6 -3TDF 3.1 ?
84 PsiBlast_CBE 82.4039% -89 - C6 -3RK8 2.1 ?
90 PsiBlast_CBE 82.3339% -90 - C6 -3PUD 2.3 ?
88 PsiBlast_CBE 82.2339% -91 - C6 -3PUE 2.3 ?
94 PsiBlast_CBE 81.1944% -85 - C6 -4I7U 2.2 DAPA_AGRFC
83 PsiBlast_CBE 81.1439% -88 - C6 -3TAK 2.1 ?
96 PsiBlast_CBE 80.8644% -83 - C6 -4I7U 3.0 DAPA_AGRFC
75 PsiBlast_CBE 80.6539% -90 - C6 -3UQN 3.2 ?
133 HHSearch 76.4236% -83 - C6 -3DAQ 2.0 DAPA_STAAR
99 PsiBlast_CBE 69.9536% -79 - C6 -3DI1 3.3 DAPA_STAAC
98 PsiBlast_CBE 68.7736% -75 - C6 -3DI1 3.1 DAPA_STAAC
100 PsiBlast_CBE 68.5336% -76 - C6 -3DI0 3.0 DAPA_STAAC
101 PsiBlast_CBE 67.6836% -76 - C6 -3DI0 3.5 DAPA_STAAC