@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu01800: (2016-06-03 )
MTWHEVNDVIVITLPEIFDMNANLGYLTREKNECMYEIENNIITKVIAIGEIRSLVQVSVINNKQMIVQFLNDSRPVEQWKREEIVKYIHEWFDLDNDLTPFYEMAKADPLLKMPARKFYGLRVIGIPDLFEALCWGVLGQQINLAFAYSLKKQFVEAFGDSIEWNGKKYWVFPPYERIARLTPTDLADIKMTVKKSEYIIGIARLMASGELSREKLMKMNFKDAEKNLIKIRGIGPWTANYVLMRCLRFPTAFPIDDVGLIHSIKILRNMNRKPTKDEILEISVPWKEWQSYATFYLWRVLY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_E_5(3CW7)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_5(3CVT)
3MG2_ECOLI
[Raw transfer]

-

21 HHSearch 91.9224%-110 - C3 -2JHN - ? -
41 Fugue 91.5124%-102 - C3 -2JHN - ? -
22 HHSearch 90.9724%-106 - C3 -1MPG - 3MG2_ECOLI -
8 PsiBlast_PDB 90.3925% -97 - C3 -3CVT 3.8 3MG2_ECOLI
24 HHSearch 90.3421%-119 - C3 -4EJY - ? -
9 PsiBlast_PDB 89.7925% -97 - C3 -3CW7 4.2 3MG2_ECOLI
14 PsiBlast_PDB 89.6525% -95 - C3 -3D4V - 3MG2_ECOLI -
7 PsiBlast_PDB 89.1525% -94 - C3 -3CVS - 3MG2_ECOLI -
4 PsiBlast_PDB 89.0225% -91 - C3 -1MPG - 3MG2_ECOLI -
13 PsiBlast_PDB 88.9025% -95 - C3 -3CWU - 3MG2_ECOLI -
12 PsiBlast_PDB 88.8225% -93 - C3 -3CWT - 3MG2_ECOLI -
6 PsiBlast_PDB 88.6525% -96 - C3 -1PVS - 3MG2_ECOLI -
10 PsiBlast_PDB 88.3625% -96 - C3 -3CWA - 3MG2_ECOLI -
23 HHSearch 87.9222%-115 - C3 -3I0W - ? -
11 PsiBlast_PDB 87.9125% -95 - C3 -3CWS - 3MG2_ECOLI -
2 PsiBlast_PDB 87.5725% -96 - C3 -3OH9 - 3MG2_ECOLI -
1 PsiBlast_PDB 87.3925% -98 - C3 -3OH6 - 3MG2_ECOLI -
3 PsiBlast_PDB 87.2025% -95 - C3 -3OGD - 3MG2_ECOLI -
5 PsiBlast_PDB 87.1525% -94 - C3 -1DIZ - 3MG2_ECOLI -
43 Fugue 83.0216%-101 - C3 -1EBM - OGG1_HUMAN -