@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11560: (2016-06-18 )
MGQSFNAPYEAIGEELLSQLVDTFYERVASHPLLKPIFPSDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAEDRSS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEM_A_2(1UX8)
TRHBO_BACSU
[Raw transfer]




HEM_A_2(1UX8)
TRHBO_BACSU
[Raw transfer]




HEM_B_6(2BKM)
?
[Raw transfer]




HEM_A_4(2BKM)
?
[Raw transfer]




HEM_A_4(2BKM)
?
[Raw transfer]




FMT_A_3(5AB8)
TRHBN_MYCTU
[Raw transfer]




82 HHSearch 91.50100%-151 - C5 -1UX8 11.5 TRHBO_BACSU
1 PsiBlast_PDB 91.50100%-151 - C5 -1UX8 11.5 TRHBO_BACSU
93 HHSearch 83.1567%-132 - C5 -2BKM 12.9 ?
21 PsiBlast_CBE 82.3468%-139 - C5 -2BKM 12.8 ?
2 PsiBlast_PDB 81.9268%-134 - C5 -2BKM 12.9 ?
33 PsiBlast_CBE 74.7339%-153 - C5 -1NGK - TRHBO_MYCTU -
7 PsiBlast_PDB 74.2539%-160 - C5 -2QRW - TRHBO_MYCTU -
92 HHSearch 73.8138%-160 * C5 *2QRW - TRHBO_MYCTU -
41 PsiBlast_CBE 73.5939%-155 - C5 -2QRW - TRHBO_MYCTU -
30 PsiBlast_CBE 73.5439%-150 - C5 -1NGK - TRHBO_MYCTU -
40 PsiBlast_CBE 73.3439%-160 - C5 -2QRW - TRHBO_MYCTU -
43 PsiBlast_CBE 73.1139%-162 - C5 -2QRW - TRHBO_MYCTU -
27 PsiBlast_CBE 73.0739%-147 - C5 -1NGK - TRHBO_MYCTU -
42 PsiBlast_CBE 73.0639%-157 - C5 -2QRW - TRHBO_MYCTU -
29 PsiBlast_CBE 73.0239%-156 - C5 -1NGK - TRHBO_MYCTU -
38 PsiBlast_CBE 72.9739%-157 - C5 -2QRW - TRHBO_MYCTU -
44 PsiBlast_CBE 72.9439%-153 - C5 -2QRW - TRHBO_MYCTU -
39 PsiBlast_CBE 72.9339%-155 - C5 -2QRW - TRHBO_MYCTU -
6 PsiBlast_PDB 72.8739%-151 - C5 -1NGK - TRHBO_MYCTU -
32 PsiBlast_CBE 72.6439%-158 - C5 -1NGK - TRHBO_MYCTU -