@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11980: (2016-06-18 )
MSHSQEKIALITGASSQGDIGTAICRKLASQGIHIFFTHWNSDTAWIEEFQQEILRMGVRCEAMKIDLSDAHAAFTIHEKISDKLGYPSILINNAAHSASDNYVSLDAKSLDEHYAVNMRSNFLLCVEFARRFKKSNLISGRIINMTSGQDLGPLPGELAYAATKGAISAFTRSLSQELAPLGITVNAVNPGPTDSTWMTDEIRNFLSPKFPMGRIGTPDDAARMIAFLASDEAEWITGQIIHSEGGFIRG

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_22(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_10(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_11(3RRO)
FABG_VIBCH
[Raw transfer]




84 PsiBlast_CBE 79.7533%-121 - C1 -4BNZ - FABG_PSEAE -
67 PsiBlast_CBE 79.1533%-124 - C1 -4BO4 - FABG_PSEAE -
96 PsiBlast_CBE 79.1133%-119 - C1 -4BNW - FABG_PSEAE -
61 PsiBlast_CBE 78.5233%-124 - C1 -4BO6 - FABG_PSEAE -
90 PsiBlast_CBE 78.1133%-122 - C1 -4BNX - FABG_PSEAE -
99 PsiBlast_CBE 77.8733%-123 - C1 -4BNV - FABG_PSEAE -
1 PsiBlast_PDB 77.7833% -92 - C1 -4JRO - ? -
94 PsiBlast_CBE 77.7633%-118 - C1 -4BNW - FABG_PSEAE -
70 PsiBlast_CBE 77.7533%-118 - C1 -4BO3 - FABG_PSEAE -
86 PsiBlast_CBE 77.6033%-118 - C1 -4BNY - FABG_PSEAE -
2 PsiBlast_PDB 77.2834% -96 - C1 -3U5T - ? -
85 PsiBlast_CBE 77.1733%-118 - C1 -4BNZ - FABG_PSEAE -
74 PsiBlast_CBE 76.8933%-122 - C1 -4BO2 - FABG_PSEAE -
73 PsiBlast_CBE 76.8533%-120 - C1 -4BO2 - FABG_PSEAE -
98 PsiBlast_CBE 76.6233%-118 - C1 -4BNV - FABG_PSEAE -
80 PsiBlast_CBE 76.5933%-123 - C1 -4BO0 - FABG_PSEAE -
60 PsiBlast_CBE 76.4333%-117 - C1 -4BO6 - FABG_PSEAE -
92 PsiBlast_CBE 76.4033%-118 - C1 -4BNX - FABG_PSEAE -
88 PsiBlast_CBE 76.1933%-124 - C1 -4BNY - FABG_PSEAE -
93 PsiBlast_CBE 76.0033%-118 - C1 -4BNX - FABG_PSEAE -
19 PsiBlast_PDB 65.9333% -98 - C1 -3RRO 3.0 FABG_VIBCH
41 PsiBlast_CBE 65.6333%-100 - C1 -3RRO 3.2 FABG_VIBCH