@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu17660: (2016-06-28 )
MTMQIKIKYLDETQTRISKIEQGDWIDLRAAEDVTIKKDEFKLVPLGVAMELPEGYEAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYALRDTEIKKGDRICQFRIMKKMPAVELVEVEHLGNEDRGGLGSTGTK

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_C_12(2XCD)
YNCF_BACSU
[Raw transfer]




UMP_D_13(4AO5)
YOSS_BACSU
[Raw transfer]




DU3_C_9(3T64)
?
[Raw transfer]




UMP_A_7(4AO5)
YOSS_BACSU
[Raw transfer]




DUR_B_5(4AOZ)
YNCF_BACSU
[Raw transfer]




EDO_B_8(3F4F)
DUT_YEAST
[Raw transfer]




DUR_B_7(4B0H)
YNCF_BACSU
[Raw transfer]




DUP_B_7(4OOP)
DUT_ARATH
[Raw transfer]




DUP_C_9(2XY3)
YOSS_BACSU
[Raw transfer]




DUP_E_21(2XCE)
YNCF_BACSU
[Raw transfer]




DUP_F_25(2XCE)
YNCF_BACSU
[Raw transfer]




DUD_E_11(2Y1T)
YOSS_BACSU
[Raw transfer]




DUP_F_14(2XY3)
YOSS_BACSU
[Raw transfer]




DUP_E_12(2XY3)
YOSS_BACSU
[Raw transfer]




DUD_E_10(2Y1T)
YOSS_BACSU
[Raw transfer]




DUP_C_14(2XCE)
YNCF_BACSU
[Raw transfer]




UMP_F_17(4AO5)
YOSS_BACSU
[Raw transfer]




DUD_D_9(2Y1T)
YOSS_BACSU
[Raw transfer]




DUD_C_8(2Y1T)
YOSS_BACSU
[Raw transfer]




UMP_C_11(4AO5)
YOSS_BACSU
[Raw transfer]




UMP_E_15(4AO5)
YOSS_BACSU
[Raw transfer]




DUD_B_7(2Y1T)
YOSS_BACSU
[Raw transfer]




DUP_D_11(2XY3)
YOSS_BACSU
[Raw transfer]




DUP_D_16(2XCE)
YNCF_BACSU
[Raw transfer]




DUP_B_12(2XCE)
YNCF_BACSU
[Raw transfer]




DUP_A_7(2XCE)
YNCF_BACSU
[Raw transfer]




DUP_A_7(2XY3)
YOSS_BACSU
[Raw transfer]




DUR_A_5(4AOO)
YNCF_BACSU
[Raw transfer]




DUR_C_11(4AOO)
YNCF_BACSU
[Raw transfer]




DUR_B_8(4AOO)
YNCF_BACSU
[Raw transfer]




DUR_C_11(4AOZ)
YNCF_BACSU
[Raw transfer]




DUR_A_4(4AOZ)
YNCF_BACSU
[Raw transfer]




DUR_C_11(4B0H)
YNCF_BACSU
[Raw transfer]




DUR_D_15(4AOO)
YNCF_BACSU
[Raw transfer]




DUR_A_4(4B0H)
YNCF_BACSU
[Raw transfer]




DUR_C_11(4B0H)
YNCF_BACSU
[Raw transfer]




DUP_B_8(2XY3)
YOSS_BACSU
[Raw transfer]




23 PsiBlast_CBE 99.25100% 0 - C- -4APZ - YNCF_BACSU -
144 Fugue 96.00100%-126 - C7 -4AOO 4.9 YNCF_BACSU
3 PsiBlast_PDB 96.00100%-126 - C7 -4AOO - YNCF_BACSU -
28 PsiBlast_CBE 95.92100%-124 - C7 -4AOZ 3.3 YNCF_BACSU
22 PsiBlast_CBE 95.90100%-116 - C7 -4B0H 3.3 YNCF_BACSU
30 PsiBlast_CBE 95.79100%-120 - C7 -4AOO 3.3 YNCF_BACSU
21 PsiBlast_CBE 95.64100%-118 - C7 -4B0H Error YNCF_BACSU
29 PsiBlast_CBE 95.56100%-126 - C7 -4AOO 3.3 YNCF_BACSU
31 PsiBlast_CBE 95.51100%-122 - C7 -4AOO 3.3 YNCF_BACSU
27 PsiBlast_CBE 95.41100%-119 - C7 -4AOZ Error YNCF_BACSU
5 PsiBlast_PDB 93.71100%-127 - C7 -4B0H 3.3 YNCF_BACSU
4 PsiBlast_PDB 93.25100%-123 - C7 -4AOZ 3.3 YNCF_BACSU
36 PsiBlast_CBE 92.84100%-128 - C7 -2XCE 3.1 YNCF_BACSU
32 PsiBlast_CBE 92.79100%-122 - C7 -2XCE 3.4 YNCF_BACSU
34 PsiBlast_CBE 92.25100%-131 - C7 -2XCE 2.9 YNCF_BACSU
33 PsiBlast_CBE 92.22100%-127 - C7 -2XCE 3.0 YNCF_BACSU
38 PsiBlast_CBE 91.85100%-128 - C7 -2XCD - YNCF_BACSU -
2 PsiBlast_PDB 91.60100%-121 - C7 -2XCE 3.3 YNCF_BACSU
39 PsiBlast_CBE 91.54100%-124 - C7 -2XCD - YNCF_BACSU -
1 PsiBlast_PDB 91.43100%-121 - C7 -2XCD - YNCF_BACSU -
41 PsiBlast_CBE 91.17100%-131 - C7 -2XCD Error YNCF_BACSU
35 PsiBlast_CBE 91.09100%-117 - C7 -2XCE 3.3 YNCF_BACSU
42 PsiBlast_CBE 90.6592%-138 - C7 -4AO5 Error YOSS_BACSU
43 PsiBlast_CBE 89.9792%-124 - C7 -4AO5 3.6 YOSS_BACSU
48 PsiBlast_CBE 89.5392%-130 - C7 -2Y1T 4.1 YOSS_BACSU
45 PsiBlast_CBE 89.4992%-136 - C7 -4AO5 Error YOSS_BACSU
44 PsiBlast_CBE 89.3892%-120 - C7 -4AO5 3.6 YOSS_BACSU
53 PsiBlast_CBE 89.2092%-131 - C7 -2XY3 3.4 YOSS_BACSU
54 PsiBlast_CBE 89.1692%-124 - C7 -2XY3 2.9 YOSS_BACSU
47 PsiBlast_CBE 89.0692%-127 - C7 -2Y1T 3.5 YOSS_BACSU
10 PsiBlast_PDB 88.9192%-134 - C7 -2Y1T 3.5 YOSS_BACSU
52 PsiBlast_CBE 88.7892%-116 - C7 -2XY3 3.2 YOSS_BACSU
9 PsiBlast_PDB 88.7192%-125 - C7 -2XY3 2.7 YOSS_BACSU
49 PsiBlast_CBE 88.5792%-118 - C7 -2Y1T 3.6 YOSS_BACSU
46 PsiBlast_CBE 88.4592%-116 - C7 -4AO5 3.6 YOSS_BACSU
56 PsiBlast_CBE 88.2892%-117 - C7 -2XY3 2.7 YOSS_BACSU
55 PsiBlast_CBE 87.1392%-121 - C7 -2XY3 2.8 YOSS_BACSU
51 PsiBlast_CBE 86.9192%-120 - C7 -2Y1T 3.3 YOSS_BACSU
133 HHSearch 71.7388% 18 - C7 -4B0H 3.3 YNCF_BACSU
142 HHSearch 59.6832% -10 - C7 -4OOP Error DUT_ARATH
140 HHSearch 50.8730% 38 - C7 -3T64 Error ?