@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22100: (2016-07-04 )
MESKVVENRLKEAKLIAVIRSKDKQEACQQIESLLDKGIRAVEVTYTTPGASDIIESFRNREDILIGAGTVISAQQAGEAAKAGAQFIVSPGFSADLAEHLSFVKTHYIPGVLTPSEIMEALTFGFTTLKLFPSGVFGIPFMKNLAGPFPQVTFIPTGGIHPSEVPDWLRAGAGAVGVGSQLGSCSKEDLQAVFQV

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KDP_A_2(2V82)
DGOA_ECOLI
[Raw transfer]




CIT_E_5(1FQ0)
ALKH_ECOLI
[Raw transfer]




CIT_D_4(1FQ0)
ALKH_ECOLI
[Raw transfer]




PYR_C_11(1EUA)
ALKH_ECOLI
[Raw transfer]




CIT_F_6(1FQ0)
ALKH_ECOLI
[Raw transfer]




PYR_E_17(1WA3)
?
[Raw transfer]




PYR_D_16(1WA3)
?
[Raw transfer]




PYR_B_14(1WA3)
?
[Raw transfer]




PYR_C_15(1WA3)
?
[Raw transfer]




PYR_B_10(1EUA)
ALKH_ECOLI
[Raw transfer]




PYR_A_9(1EUA)
ALKH_ECOLI
[Raw transfer]




CIT_D_4(1FWR)
ALKH_ECOLI
[Raw transfer]




CIT_E_5(1FWR)
ALKH_ECOLI
[Raw transfer]




PYR_A_13(1WA3)
?
[Raw transfer]




PYR_F_18(1WA3)
?
[Raw transfer]




CIT_F_6(1FWR)
ALKH_ECOLI
[Raw transfer]




PYR_A_3(3VCR)
?
[Raw transfer]




PYR_A_3(3VCR)
?
[Raw transfer]




56 HHSearch 92.8333%-110 * C2 *4BK9 - ? -
4 PsiBlast_PDB 88.8335%-128 - C2 -4BK9 - ? -
28 PsiBlast_CBE 87.5935%-130 - C2 -4BK9 - ? -
29 PsiBlast_CBE 86.5935%-127 - C2 -4BK9 - ? -
25 PsiBlast_CBE 86.1140% -44 - C2 -1WA3 2.9 ?
61 HHSearch 85.9838% -35 - C2 -1WA3 3.0 ?
2 PsiBlast_PDB 85.7040% -40 - C2 -1WA3 - ? -
1 PsiBlast_PDB 85.3240% -42 - C2 -1VLW - ? -
59 HHSearch 84.9932%-108 - C2 -2YW3 - ? -
24 PsiBlast_CBE 84.9040% -41 - C2 -1WA3 3.0 ?
23 PsiBlast_CBE 84.7040% -42 - C2 -1WA3 2.9 ?
16 PsiBlast_PDB 84.4437% -82 - C2 -3VCR 3.3 ?
22 PsiBlast_CBE 84.3140% -39 - C2 -1WA3 2.9 ?
54 HHSearch 84.0933% -55 - C2 -4E38 - ? -
21 PsiBlast_CBE 83.4440% -40 - C2 -1WA3 3.0 ?
46 PsiBlast_CBE 83.0735%-128 - C2 -2YW3 - ? -
45 PsiBlast_CBE 82.8635%-127 - C2 -2YW3 - ? -
15 PsiBlast_PDB 82.6435%-131 - C2 -2YW4 - ? -
3 PsiBlast_PDB 81.8736% -68 - C2 -4E38 - ? -
60 HHSearch 81.7236% -62 - C2 -3VCR 3.3 ?
30 PsiBlast_CBE 73.6837% -53 - C2 -1FQ0 4.2 ALKH_ECOLI
31 PsiBlast_CBE 73.3837% -54 - C2 -1FQ0 3.0 ALKH_ECOLI
35 PsiBlast_CBE 73.2237% -54 - C2 -1EUA 3.1 ALKH_ECOLI
34 PsiBlast_CBE 72.5037% -49 - C2 -1EUA 2.8 ALKH_ECOLI
19 PsiBlast_PDB 71.8331% -58 - C2 -2V82 4.1 DGOA_ECOLI
41 PsiBlast_CBE 71.6436% -48 - C2 -1FWR 2.8 ALKH_ECOLI
13 PsiBlast_PDB 71.3036% -49 - C2 -1FWR 2.5 ALKH_ECOLI
5 PsiBlast_PDB 71.1537% -54 - C2 -1FQ0 4.4 ALKH_ECOLI
40 PsiBlast_CBE 70.7336% -48 - C2 -1FWR 3.0 ALKH_ECOLI
6 PsiBlast_PDB 70.3737% -47 - C2 -1EUA 2.8 ALKH_ECOLI