@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu40540: (2016-08-07 )
MSEKKNIYPNKEGCPVEFTLDVIGGKWKGILFYHMIDGKKRFNEFRRICPSITQRMLTLQLRELEADGIVHREVYHQVPPKVEYSLTEFGRTLEPIVLQMKEWGESNRDVLESYRSNGLVKDQQK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_12(4A5M)
YYBR_BACSU
[Raw transfer]




BME_D_8(4A5N)
YYBR_BACSU
[Raw transfer]




BME_A_5(4A5N)
YYBR_BACSU
[Raw transfer]




EDO_E_15(4A5M)
YYBR_BACSU
[Raw transfer]




BME_A_5(4A5N)
YYBR_BACSU
[Raw transfer]




BME_B_6(4A5N)
YYBR_BACSU
[Raw transfer]




BME_C_7(4A5N)
YYBR_BACSU
[Raw transfer]




38 HHSearch 97.0199%-180 - C3 -4A5N 2.0 YYBR_BACSU
2 PsiBlast_PDB 97.0199%-180 - C3 -4A5N 2.0 YYBR_BACSU
27 PsiBlast_CBE 94.7599%-182 - C3 -4A5N 1.8 YYBR_BACSU
25 PsiBlast_CBE 93.5199%-174 - C3 -4A5N 2.6 YYBR_BACSU
26 PsiBlast_CBE 92.5499%-180 - C3 -4A5N 2.7 YYBR_BACSU
24 PsiBlast_CBE 92.43100%-179 - C3 -4A5M - YYBR_BACSU -
1 PsiBlast_PDB 91.18100%-171 - C3 -4A5M 2.4 YYBR_BACSU
22 PsiBlast_CBE 91.10100%-172 - C3 -4A5M - YYBR_BACSU -
21 PsiBlast_CBE 90.19100%-152 - C3 -4A5M - YYBR_BACSU -
23 PsiBlast_CBE 89.64100%-173 - C3 -4A5M 3.0 YYBR_BACSU
46 HHSearch 71.1456%-146 * C3 *2HZT - YTCD_BACSU -
3 PsiBlast_PDB 71.0755%-146 - C3 -2HZT - YTCD_BACSU -
4 PsiBlast_PDB 69.9240%-139 - C3 -1Z7U - ? -
43 HHSearch 68.3639%-147 - C3 -1Z7U - ? -
41 HHSearch 68.1031%-188 - C- -2FSW - ? -
5 PsiBlast_PDB 67.3831%-191 - C- -2FSW - ? -
39 HHSearch 64.2326%-151 - C3 -4GCV - ? -
42 HHSearch 63.9830%-149 - C3 -2F2E - ? -
6 PsiBlast_PDB 63.3333%-141 - C3 -2F2E - ? -
9 PsiBlast_PDB 63.1727%-136 - C3 -4GCV - ? -