@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3547: (2016-05-21 )
MPKSPPRFLNSPLSDFFIKWMSRINTWMYRRNDGEGLGGTFQKIPVALLTTTGRKTGQPRVNPLYFLRDGGRVIVAASKGGAEKNPMWYLNLKANPKVQVQIKKEVLDLTARDATDEERAEYWPQLVTMYPSYQDYQSWTDRTIPIVVCEP

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

F42_C_13(3R5W)
DDN_MYCTU
[Raw transfer]




F42_A_11(3R5W)
DDN_MYCTU
[Raw transfer]




F42_O_20(3R5W)
DDN_MYCTU
[Raw transfer]




F42_M_18(3R5W)
DDN_MYCTU
[Raw transfer]




F42_B_12(3R5W)
DDN_MYCTU
[Raw transfer]




EDO_B_10(1VL7)
?
[Raw transfer]




F42_L_17(3R5W)
DDN_MYCTU
[Raw transfer]




F42_B_7(3R5R)
DDN_MYCTU
[Raw transfer]




F42_E_15(3R5W)
DDN_MYCTU
[Raw transfer]




F42_E_10(3R5R)
DDN_MYCTU
[Raw transfer]




F42_K_16(3R5W)
DDN_MYCTU
[Raw transfer]




F42_B_6(3R5Y)
?
[Raw transfer]




F42_D_14(3R5W)
DDN_MYCTU
[Raw transfer]




F42_D_9(3R5R)
DDN_MYCTU
[Raw transfer]




F42_C_8(3R5R)
DDN_MYCTU
[Raw transfer]




F42_A_6(3R5R)
DDN_MYCTU
[Raw transfer]




F42_A_5(3R5Y)
?
[Raw transfer]




F42_C_7(3R5Y)
?
[Raw transfer]




F42_D_8(3R5Y)
?
[Raw transfer]




F42_B_4(3R5Z)
?
[Raw transfer]




F42_A_3(3R5Z)
?
[Raw transfer]




F42_N_19(3R5W)
DDN_MYCTU
[Raw transfer]




MES_A_2(3R5L)
DDN_MYCTU
[Raw transfer]




1 PsiBlast_PDB 95.8498%-122 - C5 -3R5L - DDN_MYCTU -
33 PsiBlast_CBE 95.56100%-130 - C5 -3R5R 11.0 DDN_MYCTU
26 PsiBlast_CBE 95.51100%-131 - C5 -3R5W 10.6 DDN_MYCTU
21 PsiBlast_CBE 95.21100%-133 - C5 -3R5W 11.3 DDN_MYCTU
31 PsiBlast_CBE 95.08100%-130 - C5 -3R5R 11.4 DDN_MYCTU
23 PsiBlast_CBE 95.04100%-129 - C5 -3R5W 10.9 DDN_MYCTU
4 PsiBlast_PDB 95.01100%-129 - C5 -3R5W 11.5 DDN_MYCTU
30 PsiBlast_CBE 95.00100%-131 - C5 -3R5R 11.3 DDN_MYCTU
24 PsiBlast_CBE 94.93100%-128 - C5 -3R5W 10.6 DDN_MYCTU
49 HHSearch 94.9096%-122 - C5 -3R5L 2.1 DDN_MYCTU
3 PsiBlast_PDB 94.84100%-128 - C5 -3R5R 11.2 DDN_MYCTU
29 PsiBlast_CBE 94.73100%-129 - C5 -3R5W 11.7 DDN_MYCTU
27 PsiBlast_CBE 94.55100%-125 - C5 -3R5W 10.9 DDN_MYCTU
25 PsiBlast_CBE 94.54100%-127 - C5 -3R5W 10.9 DDN_MYCTU
2 PsiBlast_PDB 94.4198%-136 - C5 -3R5P - DDN_MYCTU -
28 PsiBlast_CBE 94.29100%-125 - C5 -3R5W 11.5 DDN_MYCTU
22 PsiBlast_CBE 94.16100%-126 - C5 -3R5W 10.6 DDN_MYCTU
32 PsiBlast_CBE 93.84100%-125 - C5 -3R5R 11.3 DDN_MYCTU
37 PsiBlast_CBE 79.0745%-114 - C5 -3R5Z 10.0 ?
35 PsiBlast_CBE 77.0844%-109 - C5 -3R5Y 10.4 ?
6 PsiBlast_PDB 77.0045%-113 - C5 -3R5Z 10.0 ?
34 PsiBlast_CBE 76.7744%-103 - C5 -3R5Y 8.6 ?
5 PsiBlast_PDB 76.4444%-106 - C5 -3R5Y 9.6 ?
36 PsiBlast_CBE 76.1944%-103 - C5 -3R5Y 9.6 ?