@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0342: (2015-12-31 )
MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGHQMRFDLAAGFPLVTTKKCHLKSIVHELLWFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLMAMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIASYALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTREPLPLPSMKLNPEVKDLFDFRFEDFELVGYEAHPHIKAPVAV

Atome Classification :

(94 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDU_A_3(3B5B)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(2VET)
TYSY_ECOLI
[Raw transfer]




UMP_C_7(1J3K)
?
[Raw transfer]




PFG_A_4(2BBQ)
TYSY_ECOLI
[Raw transfer]




UMP_A_5(3QG2)
?
[Raw transfer]




NDN_B_4(3B5B)
TYSY_ECOLI
[Raw transfer]




PFG_B_6(2BBQ)
TYSY_ECOLI
[Raw transfer]




D16_F_6(2KCE)
TYSY_ECOLI
[Raw transfer]




D16_D_4(2KCE)
TYSY_ECOLI
[Raw transfer]




UFP_D_8(4FOA)
TYSY_MYCTU
[Raw transfer]




DDU_E_5(1AOB)
TYSY_ECOLI
[Raw transfer]




GOL_A_6(1F4B)
TYSY_ECOLI
[Raw transfer]




NDU_A_3(3BHL)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(2TSC)
TYSY_ECOLI
[Raw transfer]




CB3_D_4(1DNA)
TYSY_ECOLI
[Raw transfer]




C2F_G_7(1TSN)
TYSY_ECOLI
[Raw transfer]




C2F_B_6(1TLS)
TYSY_ECOLI
[Raw transfer]




NDU_A_4(3B9H)
TYSY_ECOLI
[Raw transfer]




D16_A_7(3NRR)
?
[Raw transfer]




CB3_A_4(2TSC)
TYSY_ECOLI
[Raw transfer]




DUR_E_5(1BDU)
TYSY_ECOLI
[Raw transfer]




F89_A_4(1TLC)
TYSY_ECOLI
[Raw transfer]




F89_I_9(1F28)
TYSY_PNECA
[Raw transfer]




CB3_A_4(1ZPR)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1KCE)
TYSY_ECOLI
[Raw transfer]




UMP_C_3(1BID)
TYSY_ECOLI
[Raw transfer]




DHF_A_3(1TYS)
TYSY_ECOLI
[Raw transfer]




CB3_E_5(1TRG)
TYSY_ECOLI
[Raw transfer]




CB3_X_5(2FTO)
TYSY_ECOLI
[Raw transfer]




NDU_A_3(3BFI)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1BQ1)
TYSY_ECOLI
[Raw transfer]




CIT_A_5(3V8H)
?
[Raw transfer]




CB3_B_6(4GEV)
TYSY_ECOLI
[Raw transfer]




CB3_B_7(4KNZ)
TYSY_ECOLI
[Raw transfer]




LYB_F_6(1JTU)
TYSY_ECOLI
[Raw transfer]




F89_A_6(1TSD)
TYSY_ECOLI
[Raw transfer]




CB3_A_6(1DDU)
TYSY_ECOLI
[Raw transfer]




C2F_A_4(1TLS)
TYSY_ECOLI
[Raw transfer]




LYD_D_4(1JUT)
TYSY_ECOLI
[Raw transfer]




F89_B_6(1TLC)
TYSY_ECOLI
[Raw transfer]




CB3_A_6(1TDU)
TYSY_ECOLI
[Raw transfer]




F89_B_6(2VF0)
TYSY_ECOLI
[Raw transfer]




GOL_D_(2A9W)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1KCE)
TYSY_ECOLI
[Raw transfer]




F89_F_6(1SYN)
TYSY_ECOLI
[Raw transfer]




LYB_D_4(1JTU)
TYSY_ECOLI
[Raw transfer]




LY3_D_4(1JTQ)
TYSY_ECOLI
[Raw transfer]




DDT_B_6(1JG0)
TYSY_ECOLI
[Raw transfer]




CB3_B_8(1TDU)
TYSY_ECOLI
[Raw transfer]




THG_A_4(3BHL)
TYSY_ECOLI
[Raw transfer]




MEF_A_5(3BGX)
TYSY_ECOLI
[Raw transfer]




THG_G_7(1KZI)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1AIQ)
TYSY_ECOLI
[Raw transfer]




CB3_F_6(1DNA)
TYSY_ECOLI
[Raw transfer]




DDT_A_4(1JG0)
TYSY_ECOLI
[Raw transfer]




DGP_B_5(1TLC)
TYSY_ECOLI
[Raw transfer]




CB3_B_8(1DDU)
TYSY_ECOLI
[Raw transfer]




F89_A_4(2VF0)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1AIQ)
TYSY_ECOLI
[Raw transfer]




CB3_F_6(1NCE)
TYSY_ECOLI
[Raw transfer]




LY3_F_6(1JTQ)
TYSY_ECOLI
[Raw transfer]




F89_E_4(1SYN)
TYSY_ECOLI
[Raw transfer]




THG_J_10(1KZI)
TYSY_ECOLI
[Raw transfer]




F89_B_8(1TSD)
TYSY_ECOLI
[Raw transfer]




CB3_D_4(1NCE)
TYSY_ECOLI
[Raw transfer]




THG_A_3(3BHR)
TYSY_ECOLI
[Raw transfer]




TP3_A_8(1F4F)
TYSY_ECOLI
[Raw transfer]




THG_B_8(3BHL)
TYSY_ECOLI
[Raw transfer]




TPR_A_6(1F4E)
TYSY_ECOLI
[Raw transfer]




MTX_B_6(1AXW)
TYSY_ECOLI
[Raw transfer]




MTX_A_4(1AXW)
TYSY_ECOLI
[Raw transfer]




LYD_F_6(1JUT)
TYSY_ECOLI
[Raw transfer]




TP2_A_8(1F4C)
TYSY_ECOLI
[Raw transfer]




CB3_E_5(1FWM)
TYSY_ECOLI
[Raw transfer]




TP2_B_9(1F4C)
TYSY_ECOLI
[Raw transfer]




BME_C_26(2A9W)
TYSY_ECOLI
[Raw transfer]




EDO_I_9(1HW4)
TYSY_HUMAN
[Raw transfer]




CB3_A_5(1AN5)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1AN5)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1ZPR)
TYSY_ECOLI
[Raw transfer]




DTT_B_9(2G8X)
TYSY_ECOLI
[Raw transfer]




DTT_A_8(2G8X)
TYSY_ECOLI
[Raw transfer]




BME_A_20(2A9W)
TYSY_ECOLI
[Raw transfer]




TP2_A_7(1F4D)
TYSY_ECOLI
[Raw transfer]




CB3_F_6(1FWM)
TYSY_ECOLI
[Raw transfer]




TMF_A_3(1BJG)
TYSY_ECOLI
[Raw transfer]




GA9_C_25(2A9W)
TYSY_ECOLI
[Raw transfer]




GA9_B_22(2A9W)
TYSY_ECOLI
[Raw transfer]




GA9_A_18(2A9W)
TYSY_ECOLI
[Raw transfer]




TP2_B_8(1F4D)
TYSY_ECOLI
[Raw transfer]




TP3_B_9(1F4F)
TYSY_ECOLI
[Raw transfer]




107 HHSearch 95.1279%-163 - C8 -3IX6 - TYSY_BRUME -
1 PsiBlast_PDB 95.1279%-163 - C8 -3IX6 - TYSY_BRUME -
30 PsiBlast_CBE 92.3569%-142 - C8 -2TSC 7.4 TYSY_ECOLI
19 PsiBlast_PDB 92.1969%-141 - C8 -3B5B 4.8 TYSY_ECOLI
3 PsiBlast_PDB 92.1769%-144 - C8 -2KCE 7.0 TYSY_ECOLI
17 PsiBlast_PDB 91.6569%-143 - C8 -2TSC 7.5 TYSY_ECOLI
4 PsiBlast_PDB 91.5369%-146 - C8 -3TMS - TYSY_ECOLI -
71 PsiBlast_CBE 91.4069%-146 - C8 -1BQ2 - TYSY_ECOLI -
18 PsiBlast_PDB 91.3169%-143 - C8 -2VET 4.7 TYSY_ECOLI
31 PsiBlast_CBE 91.2869%-140 - C8 -3B5B 5.9 TYSY_ECOLI
21 PsiBlast_CBE 91.2769%-142 - C8 -2KCE 6.3 TYSY_ECOLI
2 PsiBlast_PDB 91.0769%-141 - C8 -2BBQ 7.4 TYSY_ECOLI
22 PsiBlast_CBE 90.9669%-142 - C8 -2BBQ 7.6 TYSY_ECOLI
101 HHSearch 90.6363%-147 - C8 -3UWL - TYSY_ENTFA -
100 PsiBlast_CBE 89.8466%-140 - C8 -4FOA 5.5 TYSY_MYCTU
104 HHSearch 87.2848%-140 - C8 -1J3K 5.4 ?
103 HHSearch 87.2555%-147 - C8 -1HW4 1.9 TYSY_HUMAN
110 HHSearch 85.7448%-140 - C8 -3QG2 4.7 ?
116 Fugue 85.0252%-139 - C8 -1QZF - ? -
108 HHSearch 84.3747%-135 - C8 -2AAZ - TYSY_CRYNJ -
113 HHSearch 84.1051%-139 - C8 -3NRR 6.0 ?
105 HHSearch 84.0049%-131 - C8 -1F28 6.7 TYSY_PNECA
106 HHSearch 80.9244%-136 - C8 -3V8H 3.2 ?
77 PsiBlast_CBE 55.1169% -38 - C8 -1FWM 5.3 TYSY_ECOLI
88 PsiBlast_CBE 55.0969% -37 - C8 -1NCE 4.2 TYSY_ECOLI
80 PsiBlast_CBE 55.0769% -37 - C8 -1AIQ 4.2 TYSY_ECOLI
13 PsiBlast_PDB 55.0269% -42 - C8 -1BID 2.7 TYSY_ECOLI
74 PsiBlast_CBE 54.9469% -40 - C8 -1BJG 3.4 TYSY_ECOLI
16 PsiBlast_PDB 54.9469% -38 - C8 -1SYN 5.2 TYSY_ECOLI
58 PsiBlast_CBE 54.7669% -39 - C8 -1JTU 4.8 TYSY_ECOLI
7 PsiBlast_PDB 54.7169% -39 - C8 -1TSD 4.9 TYSY_ECOLI
84 PsiBlast_CBE 54.5869% -38 - C8 -3BFI 0.4 TYSY_ECOLI
98 PsiBlast_CBE 54.5768% -41 - C8 -1JG0 4.7 TYSY_ECOLI
10 PsiBlast_PDB 54.5069% -39 - C8 -1AN5 4.8 TYSY_ECOLI
87 PsiBlast_CBE 54.4569% -35 - C8 -1TYS 3.7 TYSY_ECOLI
54 PsiBlast_CBE 54.3169% -40 - C8 -1KCE 3.6 TYSY_ECOLI
42 PsiBlast_CBE 54.3069% -34 - C8 -3BHL 6.0 TYSY_ECOLI
25 PsiBlast_CBE 54.2969% -42 - C8 -1TDU 2.9 TYSY_ECOLI
12 PsiBlast_PDB 54.2869% -36 - C8 -1BDU 2.8 TYSY_ECOLI
15 PsiBlast_PDB 54.2569% -42 - C8 -1TRG 4.3 TYSY_ECOLI
59 PsiBlast_CBE 54.2269% -39 - C8 -1JTQ 4.5 TYSY_ECOLI
9 PsiBlast_PDB 54.1169% -43 - C8 -1TDU 4.3 TYSY_ECOLI
24 PsiBlast_CBE 54.0669% -44 - C8 -1TLC 4.2 TYSY_ECOLI
73 PsiBlast_CBE 54.0069% -39 - C8 -1DNA 3.4 TYSY_ECOLI
78 PsiBlast_CBE 53.9869% -37 - C8 -1FWM 5.0 TYSY_ECOLI
23 PsiBlast_CBE 53.9469% -41 - C8 -1TSD 6.7 TYSY_ECOLI
41 PsiBlast_CBE 53.9169% -37 - C8 -3BHL 4.7 TYSY_ECOLI
50 PsiBlast_CBE 53.7969% -37 - C8 -1TLS 3.0 TYSY_ECOLI
53 PsiBlast_CBE 53.7769% -39 - C8 -1KZI 3.4 TYSY_ECOLI
81 PsiBlast_CBE 53.7669% -37 - C8 -4GEV 4.9 TYSY_ECOLI
29 PsiBlast_CBE 53.7469% -36 - C8 -1AN5 2.7 TYSY_ECOLI
11 PsiBlast_PDB 53.7269% -42 - C8 -1AXW 4.4 TYSY_ECOLI
20 PsiBlast_PDB 53.7169% -38 - C8 -1KCE 5.3 TYSY_ECOLI
32 PsiBlast_CBE 53.5769% -36 - C8 -4KNZ 4.2 TYSY_ECOLI
56 PsiBlast_CBE 53.4669% -37 - C8 -1JUT 4.1 TYSY_ECOLI
6 PsiBlast_PDB 53.4369% -38 - C8 -1TLC 5.6 TYSY_ECOLI
72 PsiBlast_CBE 53.4069% -38 - C8 -1DNA 4.7 TYSY_ECOLI
67 PsiBlast_CBE 53.2969% -37 - C8 -1ZPR 5.6 TYSY_ECOLI
40 PsiBlast_CBE 53.2269% -36 - C8 -3BHR 6.1 TYSY_ECOLI
26 PsiBlast_CBE 53.2069% -41 - C8 -1SYN 5.8 TYSY_ECOLI
55 PsiBlast_CBE 53.1669% -38 - C8 -1JUT 6.0 TYSY_ECOLI
51 PsiBlast_CBE 53.1669% -35 - C8 -1TLS 2.6 TYSY_ECOLI
99 PsiBlast_CBE 53.1468% -39 - C8 -1JG0 4.7 TYSY_ECOLI
70 PsiBlast_CBE 53.0169% -40 - C8 -2VF0 4.9 TYSY_ECOLI
5 PsiBlast_PDB 52.9369% -36 - C8 -1AOB 3.5 TYSY_ECOLI
69 PsiBlast_CBE 52.9269% -41 - C8 -2VF0 5.4 TYSY_ECOLI
86 PsiBlast_CBE 52.8369% -35 - C8 -3BGX 3.6 TYSY_ECOLI
52 PsiBlast_CBE 52.8269% -39 - C8 -1KZI 3.0 TYSY_ECOLI
49 PsiBlast_CBE 52.7969% -34 - C8 -1TSN 3.7 TYSY_ECOLI
47 PsiBlast_CBE 52.7269% -38 - C8 -2A9W 4.8 TYSY_ECOLI
28 PsiBlast_CBE 52.6869% -41 - C8 -1AXW 3.6 TYSY_ECOLI
97 PsiBlast_CBE 52.6568% -39 - C8 -1F4D 1.4 TYSY_ECOLI
66 PsiBlast_CBE 52.6569% -38 - C8 -1F4B 3.3 TYSY_ECOLI
75 PsiBlast_CBE 52.6369% -35 - C8 -2FTO 5.0 TYSY_ECOLI
46 PsiBlast_CBE 52.6069% -39 - C8 -2A9W 5.6 TYSY_ECOLI
43 PsiBlast_CBE 52.6069% -35 - C8 -3B9H 0.5 TYSY_ECOLI
83 PsiBlast_CBE 52.5969% -40 - C8 -2G8X 2.5 TYSY_ECOLI
65 PsiBlast_CBE 52.5669% -39 - C8 -1F4C 2.3 TYSY_ECOLI
45 PsiBlast_CBE 52.5469% -39 - C8 -2A9W 1.7 TYSY_ECOLI
85 PsiBlast_CBE 52.5269% -37 - C8 -1BQ1 5.4 TYSY_ECOLI
8 PsiBlast_PDB 52.5269% -34 - C8 -1DDU 4.2 TYSY_ECOLI
68 PsiBlast_CBE 52.4769% -35 - C8 -1ZPR 5.2 TYSY_ECOLI
63 PsiBlast_CBE 52.4069% -36 - C8 -1F4E 2.9 TYSY_ECOLI
60 PsiBlast_CBE 52.3869% -36 - C8 -1JTQ 4.2 TYSY_ECOLI
48 PsiBlast_CBE 52.3669% -37 - C8 -2A9W 5.0 TYSY_ECOLI
89 PsiBlast_CBE 52.1569% -36 * C8 *1NCE 4.1 TYSY_ECOLI
57 PsiBlast_CBE 52.1369% -38 - C8 -1JTU 3.4 TYSY_ECOLI
27 PsiBlast_CBE 52.1069% -35 - C8 -1DDU 4.6 TYSY_ECOLI
62 PsiBlast_CBE 51.8769% -37 - C8 -1F4F 1.4 TYSY_ECOLI
61 PsiBlast_CBE 51.8769% -38 - C8 -1F4F 1.7 TYSY_ECOLI
79 PsiBlast_CBE 51.8669% -35 - C8 -1AIQ 3.1 TYSY_ECOLI
96 PsiBlast_CBE 51.8268% -36 - C8 -1F4D 1.4 TYSY_ECOLI
82 PsiBlast_CBE 51.7969% -40 - C8 -2G8X 2.2 TYSY_ECOLI
64 PsiBlast_CBE 51.3569% -36 - C8 -1F4C 2.2 TYSY_ECOLI