@TOME V3
(Feb 2022)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : E0RY10_BUTPB: (2019-01-27 )
MMDSQIQSLPEAIRKYIEGREYTIDDMGKSGSKVLIFEDMVLKITDKPCDDKDAVEMMRWLEGKIPAPQVIVFEEDDSYSYLLMTKVRGKVACDKYYLERPKELVPLLSKSIKMLQSIDITDCPVVKNVDRELKKAAYRVKNGLVDISDAEPDTFGENGRFRDPEELLSWLQENRPPYEPVLSHGDLCLPNILIEKGNISGFIDMGNCGIADKWEDIAILYRSLRHNFDGTYGKIYPGLEPDSFFEELGIEPDREKIDYYILLDELF

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KAN_B_10(1ND4)
KKA2_KLEPN
[Raw transfer]




B31_A_3(3TM0)
KKA3_ENTFL
[Raw transfer]




B31_A_3(3TM0)
KKA3_ENTFL
[Raw transfer]




73 HHSearch 83.2142% 15 - C6 -3TM0 2.9 KKA3_ENTFL
74 HHSearch 83.1042% 12 - C6 -1L8T - KKA3_ENTFL -
8 PsiBlast_PDB 79.0338% 47 - C6 -3TM0 2.9 KKA3_ENTFL
55 Fugue 77.1540% 32 - C6 -1J7L - KKA3_ENTFL -
6 PsiBlast_PDB 77.0038% 51 - C6 -1L8T - KKA3_ENTFL -
24 Blastp_CBE 76.8839% 51 - C6 -1J7L - KKA3_ENTFL -
22 Blastp_CBE 76.3539% 51 - C6 -3Q2J - KKA3_ENTFL -
23 Blastp_CBE 76.1839% 52 - C6 -1J7U - KKA3_ENTFL -
45 SP3 75.8138% 30 - C6 -1J7L - KKA3_ENTFL -
4 PsiBlast_PDB 75.1538% 51 - C6 -1J7U - KKA3_ENTFL -
5 PsiBlast_PDB 74.8738% 51 - C6 -3Q2J - KKA3_ENTFL -
7 PsiBlast_PDB 74.7738% 49 - C6 -2B0Q - KKA3_ENTFL -
3 PsiBlast_PDB 74.6338% 50 - C6 -1J7L - KKA3_ENTFL -
21 Blastp_CBE 74.5539% 52 - C6 -2BKK - KKA3_ENTFL -
2 PsiBlast_PDB 73.9138% 52 - C6 -1J7I - KKA3_ENTFL -
46 SP3 73.2527% -9 - C6 -1ND4 - KKA2_KLEPN -
72 HHSearch 72.2629% 11 - C6 -4GKI - ? -
75 HHSearch 71.5728% 1 - C6 -1ND4 - KKA2_KLEPN -
1 PsiBlast_PDB 70.9638% 49 - C6 -2BKK - KKA3_ENTFL -
71 HHSearch 69.7729% 16 * C6 *4GKH - ? -
25 Blastp_CBE 59.5631% 12 - C6 -1ND4 3.7 KKA2_KLEPN