@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VT81: (2017-12-12 )
MEMMMKSIKHLAFPLLSAALVMTGCASRKPATTATTGTTNPSTVNTTGLSEDAALNAQNLAGASSKGVTEANKAALAKRIVHFDYDSSDLSTEDYQTLQAHAQFLMANANSKVALTGHTDERGTREYNMALGERRAKAVQNYLITSGVNPQQLEAVSYGKEAPVNPGHDESAWKENRRVEINYEAVPPLLK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

7QA_C_16(5U1H)
PORF_PSEAE
[Raw transfer]




API_A_2(4G4V)
?
[Raw transfer]




7QA_A_5(5U1H)
PORF_PSEAE
[Raw transfer]




GOL_A_5(4G4W)
?
[Raw transfer]




GOL_A_4(4G4X)
?
[Raw transfer]




GOL_A_4(4G4X)
?
[Raw transfer]




74 HHSearch 84.4599% -27 - C4 -4G4V 4.7 ?
1 PsiBlast_PDB 84.4599% -27 - C4 -4G4V - ? -
2 PsiBlast_PDB 83.2999% -27 - C4 -4G4W 2.6 ?
75 HHSearch 82.5599% -23 - C4 -4G4X 2.1 ?
3 PsiBlast_PDB 82.5599% -23 - C4 -4G4X 2.1 ?
4 PsiBlast_PDB 72.8344% -58 - C4 -4R40 - ? -
6 PsiBlast_PDB 72.1552% -63 - C4 -4PWT - ? -
25 PsiBlast_CBE 71.9052% -55 - C4 -2HQS - PAL_ECOLI -
72 HHSearch 70.9748% -30 - C4 -2AIZ - PAL_HAEIN -
27 PsiBlast_CBE 70.7952% -47 - C4 -2HQS - PAL_ECOLI -
8 PsiBlast_PDB 70.7352% -58 - C4 -2W8B - PAL_ECOLI -
66 HHSearch 69.9148% -42 - C4 -4B5C - ? -
7 PsiBlast_PDB 69.7152% -50 - C4 -2HQS - PAL_ECOLI -
76 HHSearch 68.8149% -51 - C4 -4PWT - ? -
80 HHSearch 68.7850% -38 * C4 *2HQS - PAL_ECOLI -
65 HHSearch 68.6448% -36 - C4 -4B5C - ? -
5 PsiBlast_PDB 67.6444% -34 - C4 -4B5C - ? -
50 Fugue 67.2950% -39 - C4 -1OAP - PAL_ECOLI -
9 PsiBlast_PDB 67.0052% -47 - C4 -1OAP - PAL_ECOLI -
78 HHSearch 66.4252% -41 - C4 -1OAP - PAL_ECOLI -
81 HHSearch 57.1934% 29 - C4 -5U1H 4.9 PORF_PSEAE
82 HHSearch 55.4234% 31 - C4 -5U1H 3.7 PORF_PSEAE