@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q68CY7_HUMAN: (2017-06-03 )
WYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKTYHRDGKYGFSDPLTFNSVVELINHY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(2IUH)
KIT_HUMAN
[Raw transfer]

-

CHAIN_D_4(2IUI)

[Raw transfer]

-

CHAIN_C_3(2IUI)
P85A_HUMAN
[Raw transfer]

-

CHAIN_B_2(1FU5)

[Raw transfer]

-

16 PsiBlast_PDB 92.0390%-105 - C4 -2IUH 9.0 KIT_HUMAN
7 PsiBlast_PDB 91.0090%-100 - C4 -4L2Y Calc...
208 HHSearch 90.8591%-102 - C4 -4L23 Calc...
6 PsiBlast_PDB 90.6090%-102 - C4 -4L23 - -
12 PsiBlast_PDB 90.2090%-119 - C4 -3HIZ Calc... P85A_HUMAN
17 PsiBlast_PDB 90.1290%-104 - C4 -2IUI 6.7 P85A_HUMAN
5 PsiBlast_PDB 90.0490%-101 - C4 -4L1B Calc...
194 HHSearch 89.4291% -96 - C4 -2IUG Calc...
15 PsiBlast_PDB 89.1690% -96 - C4 -2IUG - -
201 HHSearch 89.0191%-101 - C4 -3HHM Calc...
21 PsiBlast_CBE 88.9690% -99 - C4 -2IUI 6.9
11 PsiBlast_PDB 88.7690%-101 - C4 -3HHM - -
9 PsiBlast_PDB 83.7890%-111 - C4 -5FI4 Calc...
3 PsiBlast_PDB 80.6290% - - C4 -4OVU Calc... P85A_HUMAN
8 PsiBlast_PDB 80.3090%-144 - C4 -4WAF Calc...
14 PsiBlast_PDB 79.6492% -53 - C4 -2PNB Calc...
13 PsiBlast_PDB 79.1892% -64 - C4 -2PNA Calc...
19 PsiBlast_PDB 77.4590% -79 - C4 -1FU6 Calc...
2 PsiBlast_PDB 74.3690% 0 - C- -4ZOP - -
1 PsiBlast_PDB 72.0390%-147 - C4 -4YKN Calc... PK3CA_HUMAN
18 PsiBlast_PDB 67.0290% -59 - C4 -1FU5 Error