@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0340: (2017-12-20 )
MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLAIYGKMEREGKKFGLGSSGSVVVLVVKALLALYNLSVDQNLLFKLTSAVLLKRGDNGSMGDLACIAAEDLVLYQSFDRQKVAAWLEEENLATVLERDWGFSISQVKPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERIGHDDKS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_3(3GON)
?
[Raw transfer]




ANP_A_3(3GON)
?
[Raw transfer]




DIO_B_2(1KKH)
MVK_METJA
[Raw transfer]




36 HHSearch 88.59100%-131 - C2 -3GON 6.1 ?
1 PsiBlast_PDB 88.59100%-131 - C2 -3GON 6.1 ?
2 PsiBlast_PDB 57.2129% -27 - C2 -3K17 - ? -
41 HHSearch 56.7830% -20 - C2 -3K17 - ? -
49 HHSearch 52.5022% -85 - C2 -4HAC - ? -
50 HHSearch 51.6522% -86 * C2 *4HAC - ? -
38 HHSearch 50.6519% -28 - C2 -4USK - ? -
39 HHSearch 50.5419% -27 - C2 -4UTG - ? -
43 HHSearch 45.9722% 5 - C2 -1KKH 2.6 MVK_METJA
47 HHSearch 45.0419% -11 - C2 -2R42 - KIME_RAT -
22 PsiBlast_CBE 42.8940%-263 - C1 -4UTG - ? -
10 PsiBlast_PDB 42.3040%-258 - C1 -4UTG - ? -
9 PsiBlast_PDB 41.6540%-252 - C1 -4UT4 - ? -
48 HHSearch 41.4821% -50 - C2 -2R3V - KIME_HUMAN -
56 HHSearch 40.9619% -22 - C2 -2DEI - GAL1_PYRHO -
8 PsiBlast_PDB 40.5740%-235 - C1 -4USK - ? -
23 PsiBlast_CBE 40.5640%-251 * C1 *4UT4 - ? -
27 Fugue 40.5219% 2 - C2 -1KVK - KIME_RAT -
57 HHSearch 40.2419% -23 - C2 -2CZ9 - GAL1_PYRHO -
7 PsiBlast_PDB 40.0940%-238 - C1 -4USM - ? -