@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0701: (2017-12-27 )
MTKRVLITGVSSGIGLAQARLFLEKGYQVYGVDQGEKPLLEGDFRFLQRDLTLDLEPIFDWCPQVDVLCNTAGVLDDYKPLLEQTAQDIQEIFEINYIIPVELTRYYLTQMLENKKGIIINMCSIASSLAGGGGHAYTSSKHALAGFTKQLALDYAEAGIQVFGIAPGAVKTAMTAADFEPGGLADWVASETPIKRWIEPEEIAELSLFLASGKASAMQGQILTIDGGWSLK

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_11(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_10(3RRO)
FABG_VIBCH
[Raw transfer]




41 PsiBlast_CBE 89.1031% -61 - C1 -1O5I - ? -
23 PsiBlast_CBE 86.5731% -25 - C1 -4NBU - ? -
24 PsiBlast_CBE 85.9031% -24 - C1 -4NBU - ? -
22 PsiBlast_CBE 85.3131% -23 - C1 -4NBU - ? -
3 PsiBlast_PDB 85.3031% -23 - C1 -4NBU - ? -
43 PsiBlast_CBE 83.3031% -13 - C1 -1Q7B - FABG_ECOLI -
44 PsiBlast_CBE 83.2831% -13 - C1 -1Q7B - FABG_ECOLI -
54 PsiBlast_CBE 82.9632% -27 - C1 -2D1Y - ? -
56 PsiBlast_CBE 82.6331% -17 - C1 -4NBT - ? -
59 PsiBlast_CBE 82.6231% -16 - C1 -4NBT - ? -
42 PsiBlast_CBE 82.5031% -12 - C1 -1Q7B - FABG_ECOLI -
55 PsiBlast_CBE 82.3232% -29 - C1 -2D1Y - ? -
45 PsiBlast_CBE 82.2631% -13 - C1 -1Q7B - FABG_ECOLI -
92 HHSearch 81.8928% -19 - C1 -4Z9Y - ? -
75 PsiBlast_CBE 81.7832% -10 - C1 -1GEE - DHG_BACME -
74 PsiBlast_CBE 81.7332% -11 - C1 -1GEE - DHG_BACME -
2 PsiBlast_PDB 81.6633% -1 - C1 -3UF0 - ? -
61 PsiBlast_CBE 81.6532% -15 - C1 -1RWB - DHG_BACME -
58 PsiBlast_CBE 81.4631% -14 - C1 -4NBT - ? -
78 PsiBlast_CBE 81.4032% -10 - C1 -1GCO - DHG_BACME -
15 PsiBlast_PDB 77.0830% -11 - C1 -3RRO 3.0 FABG_VIBCH