@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VSH4: (2017-12-08 )
MVIDFKQDILAPVATDFAAMDHLINEGISSKVGLVMSVSKHVVEAGGKRMRPIMCLLAARACGLDNMQNAQRLAAIIEMLHTATLVHDDVVDESGLRRGRPTANATWNNQTAVLVGDFLIARAFDLLVDLNNMTLLKDFSTGTCEIAEGEVLQLQSQHQPDTTEETYLKIIHGKTSRLFELATEGAAILAGQEAYREPLRLFAGHFGNAFQIIDDILDYTSDAETLGKNIGDDLMEGKPTLPLISALAHSTGEEHAIIRRSIATGGVDQLPKVIEIVQKSGALDYCQRRAQEETEAALQALSILPDTPYRQALINLTRLALHRIQ

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RIS_B_12(1RQJ)
ISPA_ECOLI
[Raw transfer]




RIS_A_10(1RQJ)
ISPA_ECOLI
[Raw transfer]




DST_D_11(3KRF)
?
[Raw transfer]




IPE_B_7(3OYR)
?
[Raw transfer]




IPE_B_7(3OYR)
?
[Raw transfer]




IPE_A_4(4LLT)
?
[Raw transfer]




DST_D_11(3KRO)
?
[Raw transfer]




DST_D_6(3OAC)
?
[Raw transfer]




DST_D_11(3OAB)
?
[Raw transfer]




IPE_A_7(3Q1O)
?
[Raw transfer]




IPE_B_9(4LLT)
?
[Raw transfer]




IPE_B_13(3Q1O)
?
[Raw transfer]




GST_A_4(4LLS)
?
[Raw transfer]




2DE_B_8(3AQC)
HEXB_MICLU
[Raw transfer]




GOL_A_5(3Q2Q)
?
[Raw transfer]




210_A_7(5ERO)
FUSS_PHOAM
[Raw transfer]




GST_B_9(4LLS)
?
[Raw transfer]




IPE_D_23(3Q1O)
?
[Raw transfer]




IPE_C_17(3Q1O)
?
[Raw transfer]




IPE_A_3(4LLS)
?
[Raw transfer]




IPR_A_12(1RQI)
ISPA_ECOLI
[Raw transfer]




IPE_A_3(3WJO)
?
[Raw transfer]




IPE_B_7(4LFE)
?
[Raw transfer]




IPE_B_8(4LLS)
?
[Raw transfer]




IPR_A_9(1RQJ)
ISPA_ECOLI
[Raw transfer]




IPR_B_11(1RQI)
ISPA_ECOLI
[Raw transfer]




CIT_A_3(3PKO)
?
[Raw transfer]




IPE_A_4(4LFG)
?
[Raw transfer]




IPR_B_11(1RQJ)
ISPA_ECOLI
[Raw transfer]




IPE_B_9(4LFG)
?
[Raw transfer]




IPE_A_4(3WJO)
?
[Raw transfer]




DMS_A_5(3ZMB)
?
[Raw transfer]




POP_A_3(3OYR)
?
[Raw transfer]




POP_A_3(3OYR)
?
[Raw transfer]




POP_A_3(3OYR)
?
[Raw transfer]




1 PsiBlast_PDB 98.2599%-123 - C1 -4LOB - ? -
73 HHSearch 90.8299% -73 - C1 -4LOB - ? -
70 HHSearch 70.8044% -96 * C1 *4JYX - ? -
22 PsiBlast_CBE 69.7046% -62 - C1 -4JYX - ? -
21 PsiBlast_CBE 69.2646% -59 - C1 -4JYX - ? -
27 PsiBlast_CBE 68.0846% -57 - C1 -4JYX - ? -
66 HHSearch 67.9545%-100 - C1 -3WJK - ? -
2 PsiBlast_PDB 67.7946% -60 - C1 -4JYX - ? -
69 HHSearch 67.7744%-100 - C1 -4JXY - ? -
67 HHSearch 67.1845%-100 - C1 -3WJO - ? -
23 PsiBlast_CBE 65.0846% -62 - C1 -4JYX - ? -
25 PsiBlast_CBE 64.2246% -62 - C1 -4JYX - ? -
71 HHSearch 63.7141% -67 - C1 -3OYR 3.5 ?
3 PsiBlast_PDB 62.4446% -67 - C1 -4JXY - ? -
26 PsiBlast_CBE 61.2846% -66 - C1 -4JYX - ? -
24 PsiBlast_CBE 60.9946% -63 - C1 -4JYX - ? -
29 PsiBlast_CBE 60.9743% -56 - C1 -3OYR 3.5 ?
91 Fugue 58.9340% -85 - C1 -3OYR 3.4 ?
72 HHSearch 58.8741% -91 - C1 -3OYR 3.4 ?
28 PsiBlast_CBE 58.6647% -49 - C1 -3WJN - ? -
5 PsiBlast_PDB 56.7143% -83 - C1 -3OYR 3.4 ?
4 PsiBlast_PDB 54.5647% -55 - C1 -3WJO 3.5 ?
9 PsiBlast_PDB 51.3433% -60 - C1 -3Q2Q 2.3 ?
15 PsiBlast_PDB 44.6632% -21 - C1 -3PKO 3.2 ?
45 PsiBlast_CBE 23.5235% -9 - C1 -3KRO 3.1 ?
46 PsiBlast_CBE 22.9035% -10 - C1 -3KRF 3.7 ?
44 PsiBlast_CBE 21.6035% -6 - C1 -3OAB 2.6 ?
43 PsiBlast_CBE 21.5035% -7 - C1 -3OAC 2.9 ?
65 PsiBlast_CBE 17.6431% -14 - C1 -1RQI 4.3 ISPA_ECOLI
56 PsiBlast_CBE 17.5232% -7 - C1 -4LFG 5.6 ?
57 PsiBlast_CBE 17.3832% -7 - C1 -4LFE 5.3 ?
55 PsiBlast_CBE 17.3532% -4 - C1 -4LFG 5.2 ?
64 PsiBlast_CBE 16.7231% -16 - C1 -1RQI 4.6 ISPA_ECOLI
62 PsiBlast_CBE 16.4631% -13 - C1 -1RQJ 4.9 ISPA_ECOLI
61 PsiBlast_CBE 15.4532% -38 - C1 -3Q1O 4.2 ?
59 PsiBlast_CBE 15.3832% -35 - C1 -3Q1O 5.2 ?
63 PsiBlast_CBE 15.0031% -12 - C1 -1RQJ 4.9 ISPA_ECOLI
60 PsiBlast_CBE 13.7332% -33 - C1 -3Q1O 3.2 ?
58 PsiBlast_CBE 12.6632% -32 - C1 -3Q1O 3.5 ?
53 PsiBlast_CBE 12.1233% -5 - C1 -4LLS 5.4 ?
51 PsiBlast_CBE 11.7933% -2 - C1 -4LLT 2.8 ?
52 PsiBlast_CBE 11.5033% -4 - C1 -4LLT 3.1 ?
54 PsiBlast_CBE 10.8733% -9 - C1 -4LLS 5.4 ?