@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y176: (2018-01-24 )
MLEKDIERILISQEEIQVRCKELGKELTEIYQNTNPLVVGVLKGAVPFMADIVRSIDTYLELDFMDVSSYGNATVSSGEVKIVKDLDTNVEGRDLLIVEDIIDSGRTLAYLVDLFKYRKAKSVKIVTLLDKPEGRVVNIEADYVGFNVPNEFVVGYGLDYAEAYRNLPYIGVLKPSVYQSN

Atome Classification :

(98 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BME_A_8(3O7M)
?
[Raw transfer]




BME_D_19(3O7M)
?
[Raw transfer]




3QG_A_7(4RHY)
HPRT_MYCTU
[Raw transfer]




3QG_C_13(4RHY)
HPRT_MYCTU
[Raw transfer]




3QG_D_16(4RHY)
HPRT_MYCTU
[Raw transfer]




3L7_B_6(5KNS)
?
[Raw transfer]




3QF_A_5(4RHX)
HPRT_MYCTU
[Raw transfer]




IMP_E_5(1P19)
?
[Raw transfer]




3QG_B_10(4RHY)
HPRT_MYCTU
[Raw transfer]




5GP_B_15(3KB8)
?
[Raw transfer]




3QF_D_14(4RHX)
HPRT_MYCTU
[Raw transfer]




3QF_C_11(4RHX)
HPRT_MYCTU
[Raw transfer]




IMP_H_8(1P17)
?
[Raw transfer]




3QF_A_5(4RHX)
HPRT_MYCTU
[Raw transfer]




3QF_D_14(4RHX)
HPRT_MYCTU
[Raw transfer]




IMP_F_6(1P17)
?
[Raw transfer]




IMP_F_6(1P17)
?
[Raw transfer]




3QF_B_8(4RHX)
HPRT_MYCTU
[Raw transfer]




3L5_A_3(5KNR)
?
[Raw transfer]




IMP_H_8(1P19)
?
[Raw transfer]




6WC_A_3(5KNX)
?
[Raw transfer]




6WB_B_5(5KNT)
?
[Raw transfer]




45T_C_12(4RHU)
HPRT_MYCTU
[Raw transfer]




IMP_G_7(1P19)
?
[Raw transfer]




6W9_A_3(5KNV)
?
[Raw transfer]




3QE_B_9(4RHU)
HPRT_MYCTU
[Raw transfer]




IMP_E_5(1P17)
?
[Raw transfer]




3L5_B_5(5KNR)
?
[Raw transfer]




45T_D_14(4RHU)
HPRT_MYCTU
[Raw transfer]




6WC_B_5(5KNX)
?
[Raw transfer]




6WC_B_5(5KNX)
?
[Raw transfer]




IMP_G_7(1P17)
?
[Raw transfer]




6WA_A_3(5KNU)
?
[Raw transfer]




5GP_E_5(1G9T)
HPRT_ECOLI
[Raw transfer]




6WA_B_6(5KNU)
?
[Raw transfer]




IMP_E_5(1G9S)
HPRT_ECOLI
[Raw transfer]




5GP_B_4(1PZM)
?
[Raw transfer]




3L7_A_3(5KNS)
?
[Raw transfer]




5GP_B_4(1PZM)
?
[Raw transfer]




3QE_A_7(4RHU)
HPRT_MYCTU
[Raw transfer]




IMP_F_6(1P19)
?
[Raw transfer]




45T_F_18(4RHU)
HPRT_MYCTU
[Raw transfer]




PRP_B_10(1P18)
?
[Raw transfer]




PRP_B_10(1I0I)
?
[Raw transfer]




45T_E_16(4RHU)
HPRT_MYCTU
[Raw transfer]




5GP_A_9(3KB8)
?
[Raw transfer]




PRP_B_10(1I14)
?
[Raw transfer]




PRP_B_10(1TC2)
?
[Raw transfer]




PRP_B_10(1I13)
?
[Raw transfer]




6WB_A_3(5KNT)
?
[Raw transfer]




6W9_B_5(5KNV)
?
[Raw transfer]




5GP_A_9(3KB8)
?
[Raw transfer]




PRP_B_9(1I0L)
?
[Raw transfer]




6QD_B_6(5K51)
HPRT_TRYBB
[Raw transfer]




6QD_D_8(5K51)
HPRT_TRYBB
[Raw transfer]




6QD_C_7(5K51)
HPRT_TRYBB
[Raw transfer]




5GP_A_3(1PZM)
?
[Raw transfer]




GOL_C_12(3O7M)
?
[Raw transfer]




GOL_A_5(3O7M)
?
[Raw transfer]




PRP_A_9(1I14)
?
[Raw transfer]




PRP_A_9(1TC2)
?
[Raw transfer]




PRP_A_9(1I0I)
?
[Raw transfer]




PRP_A_9(1I13)
?
[Raw transfer]




PRP_A_9(1P18)
?
[Raw transfer]




IMP_A_9(1YFZ)
?
[Raw transfer]




IMP_B_10(1YFZ)
?
[Raw transfer]




FMB_D_4(1TC1)
?
[Raw transfer]




7HP_B_8(1TC2)
?
[Raw transfer]




MES_B_7(3HVU)
?
[Raw transfer]




FMB_D_4(1TC1)
?
[Raw transfer]




MES_D_11(3HVU)
?
[Raw transfer]




MES_D_11(3HVU)
?
[Raw transfer]




PRP_A_8(1I0L)
?
[Raw transfer]




MES_A_5(3HVU)
?
[Raw transfer]




FMB_C_3(1TC1)
?
[Raw transfer]




MES_C_9(3HVU)
?
[Raw transfer]




EPE_B_12(4QYI)
?
[Raw transfer]




7HP_A_7(1I0I)
?
[Raw transfer]




EPE_B_12(4QYI)
?
[Raw transfer]




SUC_B_10(3H83)
?
[Raw transfer]




EPE_C_16(4QYI)
?
[Raw transfer]




6RH_A_3(5KAP)
HPRT_TRYBB
[Raw transfer]




5GP_B_10(4RHT)
HPRT_MYCTU
[Raw transfer]




6RH_B_9(5KAP)
HPRT_TRYBB
[Raw transfer]




5GP_D_18(4RHT)
HPRT_MYCTU
[Raw transfer]




5GP_A_6(4RHT)
HPRT_MYCTU
[Raw transfer]




5GP_B_8(5JV5)
HPRT_TRYBB
[Raw transfer]




5GP_A_3(5JV5)
HPRT_TRYBB
[Raw transfer]




SUC_A_6(3H83)
?
[Raw transfer]




5GP_A_3(5JV5)
HPRT_TRYBB
[Raw transfer]




5GP_C_14(4RHT)
HPRT_MYCTU
[Raw transfer]




N_F_6(1G9T)
HPRT_ECOLI
[Raw transfer]




N_F_6(1G9S)
HPRT_ECOLI
[Raw transfer]




23 PsiBlast_CBE 92.5573%-164 - C2 -3KB8 5.7 ?
1 PsiBlast_PDB 91.1473%-162 - C2 -3H83 3.0 ?
3 PsiBlast_PDB 90.6573%-163 - C2 -3KB8 5.5 ?
127 HHSearch 90.5674%-162 - C2 -3KB8 5.5 ?
29 PsiBlast_CBE 89.8173%-156 - C2 -3H83 4.4 ?
6 PsiBlast_PDB 88.7656%-162 - C2 -1YFZ 5.3 ?
26 PsiBlast_CBE 88.2673%-156 - C2 -3HVU 2.0 ?
2 PsiBlast_PDB 88.2073%-155 - C2 -3HVU 2.3 ?
30 PsiBlast_CBE 88.1456%-164 - C2 -1YFZ 5.5 ?
25 PsiBlast_CBE 88.0973%-153 - C2 -3HVU 2.0 ?
24 PsiBlast_CBE 87.3173%-151 - C2 -3HVU 2.2 ?
128 HHSearch 87.2174%-151 - C2 -3HVU 2.2 ?
5 PsiBlast_PDB 86.9656%-166 - C2 -1R3U - ? -
7 PsiBlast_PDB 86.7456%-168 - C2 -2GEB - ? -
21 PsiBlast_CBE 86.7273%-151 - C2 -3KB8 - ? -
130 HHSearch 86.7057%-168 - C2 -2GEB - ? -
22 PsiBlast_CBE 85.6273%-151 - C2 -3KB8 - ? -
126 HHSearch 85.5054%-162 - C2 -4RQA - ? -
4 PsiBlast_PDB 85.0453%-165 - C2 -4RQB - ? -
125 HHSearch 84.5454%-165 - C2 -4RQB - ? -
50 PsiBlast_CBE 84.1048%-174 - C2 -4QYI 1.9 ?
123 HHSearch 83.3646%-175 - C2 -4QYI 2.3 ?
20 PsiBlast_PDB 82.2348%-180 - C2 -3O7M 2.1 ?
19 PsiBlast_PDB 81.3348%-175 - C2 -4QYI 2.3 ?
43 PsiBlast_CBE 80.9048%-185 - C2 -3O7M 3.9 ?
42 PsiBlast_CBE 79.2048%-185 - C2 -3O7M Error ?
141 HHSearch 74.0245% -29 - C2 -1TC1 4.0 ?
76 PsiBlast_CBE 73.3845% -35 - C2 -1TC2 6.9 ?
88 PsiBlast_CBE 73.2145% -34 - C2 -1I14 6.5 ?
92 PsiBlast_CBE 72.9345% -37 - C2 -1I0I 6.9 ?
94 PsiBlast_CBE 72.9045% -36 - C2 -1I13 7.0 ?
74 PsiBlast_CBE 72.9045% -29 - C2 -1TC1 4.0 ?
82 PsiBlast_CBE 72.2545% -39 - C2 -1P18 6.6 ?
93 PsiBlast_CBE 71.8445% -31 - C2 -1I0I 4.3 ?
95 PsiBlast_CBE 71.5445% -29 - C2 -1I13 3.3 ?
89 PsiBlast_CBE 71.4545% -25 - C2 -1I14 4.1 ?
85 PsiBlast_CBE 71.3945% -29 - C2 -1P17 3.9 ?
90 PsiBlast_CBE 71.2445% -30 - C2 -1I0L 6.7 ?
83 PsiBlast_CBE 71.2445% -26 - C2 -1P18 3.7 ?
81 PsiBlast_CBE 69.8045% -26 - C2 -1P19 3.8 ?
87 PsiBlast_CBE 69.6945% -29 - C2 -1P17 4.7 ?
77 PsiBlast_CBE 69.6745% -28 - C2 -1TC2 4.3 ?
91 PsiBlast_CBE 69.4745% -24 - C2 -1I0L 2.9 ?
142 HHSearch 69.1744% -29 - C2 -1P17 6.4 ?
86 PsiBlast_CBE 68.9245% -30 - C2 -1P17 6.4 ?
79 PsiBlast_CBE 68.9145% -18 - C2 -1P19 4.8 ?
78 PsiBlast_CBE 68.8545% -41 - C2 -1P19 5.1 ?
138 HHSearch 68.0647% -56 - C2 -5KNX 4.9 ?
84 PsiBlast_CBE 68.0145% -49 - C2 -1P17 5.9 ?
12 PsiBlast_PDB 67.6149% -60 - C2 -5KNT 5.8 ?
75 PsiBlast_CBE 67.2445% -46 - C2 -1TC1 3.2 ?
39 PsiBlast_CBE 66.6448% -60 - C2 -1G9T 3.3 HPRT_ECOLI
14 PsiBlast_PDB 66.6449% -58 - C2 -5KNV 4.3 ?
121 HHSearch 66.1650% -12 - C2 -4RHX 9.1 HPRT_MYCTU
11 PsiBlast_PDB 65.5349% -55 - C2 -5KNS 5.7 ?
56 PsiBlast_CBE 65.3249% -1 - C2 -4RHY 7.5 HPRT_MYCTU
58 PsiBlast_CBE 65.2149% -25 - C2 -4RHY 8.1 HPRT_MYCTU
63 PsiBlast_CBE 65.1849% -12 - C2 -4RHX 9.1 HPRT_MYCTU
72 PsiBlast_CBE 65.0249% -40 - C2 -4RHT 3.1 HPRT_MYCTU
61 PsiBlast_CBE 64.8649% -4 - C2 -4RHX 8.4 HPRT_MYCTU
68 PsiBlast_CBE 64.5749% 5 - C2 -4RHU 6.0 HPRT_MYCTU
59 PsiBlast_CBE 64.2149% -17 - C2 -4RHY 8.0 HPRT_MYCTU
13 PsiBlast_PDB 64.1849% -54 - C2 -5KNU 5.1 ?
33 PsiBlast_CBE 64.0949% -53 - C2 -5KNV 4.2 ?
80 PsiBlast_CBE 63.9845% -34 - C2 -1P19 5.7 ?
32 PsiBlast_CBE 63.9449% -57 - C2 -5KNX 4.9 ?
40 PsiBlast_CBE 63.5848% -57 - C2 -1G9S 3.1 HPRT_ECOLI
67 PsiBlast_CBE 63.5349% -5 - C2 -4RHU 6.1 HPRT_MYCTU
36 PsiBlast_CBE 63.3549% -56 - C2 -5KNS 6.0 ?
70 PsiBlast_CBE 63.3149% -40 - C2 -4RHT 5.2 HPRT_MYCTU
10 PsiBlast_PDB 63.2849% -60 - C2 -5KNR 5.7 ?
15 PsiBlast_PDB 63.2349% -68 - C2 -5KNX 3.5 ?
64 PsiBlast_CBE 63.0249% -21 - C2 -4RHU 5.9 HPRT_MYCTU
35 PsiBlast_CBE 63.0249% -54 - C2 -5KNT 4.9 ?
34 PsiBlast_CBE 62.7149% -66 - C2 -5KNU 3.7 ?
73 PsiBlast_CBE 62.4449% -22 - C2 -4RHT 3.3 HPRT_MYCTU
57 PsiBlast_CBE 62.2549% -2 - C2 -4RHY 7.3 HPRT_MYCTU
17 PsiBlast_PDB 62.0248% -61 - C2 -1G9T 5.8 HPRT_ECOLI
133 HHSearch 61.5837% -27 - C2 -5JV5 3.8 HPRT_TRYBB
16 PsiBlast_PDB 61.5648% -51 - C2 -1G9S 5.2 HPRT_ECOLI
122 HHSearch 61.4550% -10 - C2 -4RHX 8.4 HPRT_MYCTU
60 PsiBlast_CBE 61.1849% -12 - C2 -4RHX 8.4 HPRT_MYCTU
37 PsiBlast_CBE 60.9049% -51 - C2 -5KNR 5.7 ?
65 PsiBlast_CBE 60.4349% -26 - C2 -4RHU 6.1 HPRT_MYCTU
69 PsiBlast_CBE 60.1849% -2 - C2 -4RHU 5.7 HPRT_MYCTU
104 PsiBlast_CBE 58.9538% -32 - C2 -5K51 6.4 HPRT_TRYBB
99 PsiBlast_CBE 58.9238% -22 - C2 -1PZM 6.2 ?
62 PsiBlast_CBE 58.4849% -5 - C2 -4RHX 8.5 HPRT_MYCTU
107 PsiBlast_CBE 58.0338% -29 - C2 -5JV5 3.9 HPRT_TRYBB
71 PsiBlast_CBE 57.5549% -0 - C2 -4RHT 3.6 HPRT_MYCTU
137 HHSearch 56.8738% -28 - C2 -1PZM 7.0 ?
106 PsiBlast_CBE 56.8038% -29 - C2 -5JV5 3.6 HPRT_TRYBB
100 PsiBlast_CBE 56.4738% -38 - C2 -5KAP 3.2 HPRT_TRYBB
66 PsiBlast_CBE 56.1749% -5 - C2 -4RHU 5.8 HPRT_MYCTU
101 PsiBlast_CBE 56.0938% -35 - C2 -5KAP 3.3 HPRT_TRYBB
102 PsiBlast_CBE 55.6438% -30 - C2 -5K51 5.9 HPRT_TRYBB
98 PsiBlast_CBE 54.1638% -29 - C2 -1PZM 7.0 ?
103 PsiBlast_CBE 53.2438% -31 - C2 -5K51 6.1 HPRT_TRYBB