@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y1X6: (2018-01-28 )
MERFDVERMIQMKIFVVGANGQIGRHLIKDLAPSSHEIFAGVRDVASQTLVKKENVSYVSFDLTWSVEKMTEAFKGIDVLIFAAGSQGKNLLQVDLDGAIKTVIAAENAHVSRYLMVSAVYADEPAKWPESMTDYYITKHYADEWLKRTNLDFVILQPVTLTNDEEVTSIQLTKPNEKASKTITRSTVAAVLAALVEETDISRTTLVLSEGSKELNTAFQEWAKEE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_2(3E8X)
?
[Raw transfer]




1 PsiBlast_PDB 74.4439% -99 - C2 -3DQP - ? -
2 PsiBlast_PDB 66.4333% -24 - C2 -3E8X 10.7 ?
98 HHSearch 66.3731% -5 - C2 -3E8X - ? -
95 HHSearch 58.2518% - - C2 -2X4G - ? -
102 HHSearch 54.4920% -59 - C2 -3E48 - ? -
84 HHSearch 54.2917% -46 * C2 *5F5N - ? -
3 PsiBlast_PDB 53.9928% -41 - C2 -3QVO - ? -
106 Fugue 51.1317% -72 - C2 -1HDO - BLVRB_HUMAN -
7 PsiBlast_PDB 50.4828% -92 - C2 -5L4L - ? -
97 HHSearch 49.9421% -41 - C2 -2JL1 - ? -
109 Fugue 49.6420% 29 - C2 -1XQ6 - Y5224_ARATH -
5 PsiBlast_PDB 49.3528% -96 - C2 -5L40 - ? -
9 PsiBlast_PDB 49.3125% -68 - C2 -5FFQ - ? -
87 HHSearch 48.3316% -38 - C2 -1XGK - NMRA_EMENI -
6 PsiBlast_PDB 48.1328% -97 - C2 -5L45 - ? -
11 PsiBlast_PDB 47.8723% -22 - C2 -2BKA - HTAI2_HUMAN -
4 PsiBlast_PDB 47.7328% -93 - C2 -5L3Z - ? -
112 Fugue 47.3517% -53 - C2 -1K6I - NMRA_EMENI -
15 PsiBlast_PDB 46.8329% -50 - C2 -2VRC - ? -
94 HHSearch 46.7018% -16 - C2 -2QW8 - EGS1_OCIBA -