@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q3Y2T0: (2018-02-01 )
MFKGVLFDLDGVITDTAEFHYRAWRKLGQEIGITIDHTFNEQLKGVSREDSLSLLLAYGGKEHSFSKEEFAELAKRKNDYYLEMIQTIEPKDVFPGVVPLLDSLKEEKIKIALASASKNGPFLLEKMGLTPYFDAIADPAEATNGKPAPDIFLLAAKAVGLKAEECIGIEDAQAGIQAILSSGAQPIGVGRAEDLGEEIPLVPDTTFLTIDYLKEKWHDHG

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

G16_A_2(1O08)
PGMB_LACLA
[Raw transfer]




G16_A_2(1O03)
PGMB_LACLA
[Raw transfer]




BG6_A_4(2WF6)
PGMB_LACLA
[Raw transfer]




BG6_A_3(3ZI4)
PGMB_LACLA
[Raw transfer]




G7P_A_4(2WF7)
PGMB_LACLA
[Raw transfer]




GRX_A_2(4C4T)
PGMB_LACLA
[Raw transfer]




G7P_A_4(2WF7)
PGMB_LACLA
[Raw transfer]




BG6_A_2(2WF5)
PGMB_LACLA
[Raw transfer]




GL1_A_5(1Z4N)
PGMB_LACLA
[Raw transfer]




GRX_A_2(4C4S)
PGMB_LACLA
[Raw transfer]




GL1_B_6(1Z4N)
PGMB_LACLA
[Raw transfer]




G6P_A_3(2WF9)
PGMB_LACLA
[Raw transfer]




GL1_A_5(1Z4O)
PGMB_LACLA
[Raw transfer]




YO5_A_3(4C4R)
PGMB_LACLA
[Raw transfer]




G1P_A_4(2WF8)
PGMB_LACLA
[Raw transfer]




GL1_B_6(1Z4O)
PGMB_LACLA
[Raw transfer]




MGF_A_4(4C4R)
PGMB_LACLA
[Raw transfer]




23 PsiBlast_CBE 85.4446%-109 - C2 -4GIB - ? -
18 PsiBlast_PDB 84.2246%-106 - C2 -4GIB - ? -
20 PsiBlast_PDB 84.0045%-144 - C2 -4G9B - PGMB_ECOLI -
43 HHSearch 83.5547%-105 - C2 -4GIB - ? -
19 PsiBlast_PDB 81.7845%-152 - C2 -3NAS - PGMB_BACSU -
5 PsiBlast_PDB 81.3466% -12 - C2 -1ZOL - PGMB_LACLA -
7 PsiBlast_PDB 81.1366% -6 - C2 -2WHE - PGMB_LACLA -
45 HHSearch 81.0445%-154 - C2 -3NAS - PGMB_BACSU -
2 PsiBlast_PDB 80.6266% -2 - C2 -1O08 6.5 PGMB_LACLA
12 PsiBlast_PDB 80.4366% -5 - C2 -2WFA - PGMB_LACLA -
9 PsiBlast_PDB 80.4266% 2 - C2 -2WF6 5.1 PGMB_LACLA
13 PsiBlast_PDB 80.3666% 0 - C2 -3ZI4 5.7 PGMB_LACLA
6 PsiBlast_PDB 80.2866% 1 - C2 -2WF5 5.5 PGMB_LACLA
3 PsiBlast_PDB 79.9566% 2 - C2 -1Z4N 4.9 PGMB_LACLA
17 PsiBlast_PDB 79.9266% -5 - C2 -3FM9 - PGMB_LACLA -
8 PsiBlast_PDB 79.8766% 3 - C2 -2WF7 5.3 PGMB_LACLA
42 HHSearch 79.6066% -1 - C2 -2WF7 5.3 PGMB_LACLA
16 PsiBlast_PDB 79.6066% 6 - C2 -4C4T 6.6 PGMB_LACLA
14 PsiBlast_PDB 79.4666% 2 - C2 -4C4R 6.5 PGMB_LACLA
1 PsiBlast_PDB 79.3066% -1 - C2 -1O03 6.6 PGMB_LACLA
11 PsiBlast_PDB 79.2266% 1 - C2 -2WF9 4.4 PGMB_LACLA
15 PsiBlast_PDB 78.4766% 2 - C2 -4C4S 6.6 PGMB_LACLA
10 PsiBlast_PDB 78.4366% 6 - C2 -2WF8 4.6 PGMB_LACLA
21 PsiBlast_CBE 78.3866% 4 - C2 -1Z4O 5.2 PGMB_LACLA
4 PsiBlast_PDB 77.8166% 4 - C2 -1Z4O 5.5 PGMB_LACLA
22 PsiBlast_CBE 72.8766% 20 - C2 -1Z4N 5.0 PGMB_LACLA