@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu14560: (2016-06-22 )
MITMENIVRDGHPALRETAEPVELPPTDAEKQQLADMIEFVKNSQNPELAEKYKLRPGVGLAAPQINIKKRMIAVHAEDASGKLYSYALFNPKIVSHSVEKSYLTSGEGCLSVDEAIPGYVPRYARIRVKGTTLEGENIDIRLKGFPAIVFQHEIDHLNGVMFYDHIDKENPFKEPENAIAIER

Atome Classification :

(54 SA) .........10........20.--...--....30..--......40........50........60........70....---.-.---.-.-----80-----.------.....--.-----------------.----90........100.--.......110....-...120-.........130.......140.......150.......160.......170.......180..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MITMENIVRDGHPALRETAEPV--ELP--PTDAEKQQ--LADMIEFVKNSQNPELAEKYKLRPGVGLAAPQINIKKRMIAV---H-A---E-D-----AS-----G------KLYSY--A-----------------L----FNPKIVSHSVEK-S--YLTSGEGCLSVDEA-IPGY---VPRYARIRVKGTTLEGENIDIRLKGFPAIVFQHEIDHLNGVMFYDHIDKENPFKEPENAIAIER
1 PsiBlast_PDB 92.1766% -92 - C5 -1LQY DEF2_GEOSE A:[1-184] MITMKDIIKEGHPTLRKVAEPV--PLP--PSEEDKRI--LQSLLDYVKMSQDPELAAKYGLRPGIGLAAPQINVSKRMIAV---H-V---T-D-----EN-----G------TLYSY--A-----------------L----FNPKIVSHSVQQ-C--YLTTGEGCLSVDRD-VPGY---VLRYARITVTGTTLDGEEVTLRLKGLPAIVFQHEIDHLNGIMFYDRINPADPFQVPDGAIPIGR
3 PsiBlast_PDB 90.3860%-103 - C5 -1LQW DEF_STAAU A:[1-183] MLTMKDIIRDGHPTLRQKAAEL--ELP--LTKEEKET--LIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAV---L-IP--D-D-----GS-----G------KSYDY--M-----------------L----VNPKIVSHSVQE-A--YLPTGEGCLSVDDN-VAGL---VHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV--
2 PsiBlast_PDB 89.6065% -76 - C5 -2OKL DEF2_BACCR A:[2-185] MLTMKDVIREGDPILRNVAEEV--SLP--ASEEDTTT--LKEMIEFVINSQDPEMAEKYSLRPGIGLAAPQIGVSKKMIAV---H-V---T-D-----AD-----G------TLYSH--A-----------------L----FNPKIISHSVER-T--YLQGGEGCLSVDRE-VPGY---VPRYTRITVKATSINGEEVKLRLKGLPAIVFQHEIDHLNGVMFYDHINKENPFAAPDDSKPLER
23 PsiBlast_CBE 89.2160% -91 - C5 -1LQW DEF_STAAU B:[1-183] MLTMKDIIRDGHPTLRQKAAEL--ELP--LTKEEKET--LIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAV---L-IP--D-D-----GS-----G------KSYDY--M-----------------L----VNPKIVSHSVQE-A--YLPTGEGCLSVDDN-VAGL---VHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV--
21 PsiBlast_CBE 88.7665% -82 - C5 -2OKL DEF2_BACCR B:[2-185] MLTMKDVIREGDPILRNVAEEV--SLP--ASEEDTTT--LKEMIEFVINSQDPEMAEKYSLRPGIGLAAPQIGVSKKMIAV---H-V---T-D-----AD-----G------TLYSH--A-----------------L----FNPKIISHSVER-T--YLQGGEGCLSVDRE-VPGY---VPRYTRITVKATSINGEEVKLRLKGLPAIVFQHEIDHLNGVMFYDHINKENPFAAPDDSKPLER
22 PsiBlast_CBE 88.0260% -97 - C5 -2AI9 DEF_STAAU B:[1-183] MLTMKDIIRDGHPTLRQKAAEL--ELP--LTKEEKET--LIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAV---L-IP--D-D-----GS-----G------KSYDY--M-----------------L----VNPKIVSHSVQE-A--YLPTGEGCLSVDDN-VAGL---VHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV--
103 HHSearch 87.4665% -77 - C5 -2OKL DEF2_BACCR A:[2-185] MLTMKDVIREGDPILRNVAEEV--SLP--ASEEDTTT--LKEMIEFVINSQDPEMAEKYSLRPGIGLAAPQIGVSKKMIAV---H-V---T-D-----AD-----G------TLYSH--A-----------------L----FNPKIISHSVERTY--L-QGGEGCLSVD-REVPGY---VPRYTRITVKATSINGEEVKLRLKGLPAIVFQHEIDHLNGVMFYDHINKENPFAAPDDSKPLER
5 PsiBlast_PDB 87.1157% -90 - C5 -1LMH DEF_STAAU A:[2-183] -LTMKDIIRDGHPTLRQKAAEL--ELP--LTKEEKET--LIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAV---L-IP--D-D-----GS-----G------KSYDY--M-----------------L----VNPKIVSHSVQE-A--YLPTGEGCLSVDDN-VAGL---VHRHNKITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKDHPLQPHTDAVEV--
4 PsiBlast_PDB 86.1860% -97 - C5 -2AI9 DEF_STAAU A:[1-183] MLTMKDIIRDGHPTLRQKAAEL--ELP--LTKEEKET--LIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAV---L-IP--D-D-----GS-----G------KSYDY--M-----------------L----VNPKIVSHSVQE-A--YLPTGEGCLSVDDN-VAGL---VHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV--
8 PsiBlast_PDB 80.7453%-102 - C5 -2OS1 DEF_ENTFA A:[1-187] MITMKDIIREGNPTLRAVAEEV--PVP--ITEEDRQL--GEDMLTFLKNSQDPVKAEELQLRGGVGLAAPQLDISKRIIAV---H-VP------------------------SL-ST--V-----------------M----YNPKILSHSVQD-V--CLGEGEGCLSVDRD-VPGY---VVRHNKITVSYFDMAGEKHKVRLKNYEAIVVQHEIDHINGIMFYDHINKENPFALKEGVLVIE-
9 PsiBlast_PDB 80.1552%-100 - C5 -2OS0 DEF_ENTFA A:[1-187] MITMKDIIREGNPTLRAVAEEV--PVP--ITEEDRQL--GEDMLTFLKNSQDPVKAEELQLRGDVGLAAPQLDISKRIIAV---H-VP------------------------SL-ST--V-----------------M----YNPKILSHSVQD-V--CLGEGEGCLSVDRD-VPGY---VVRHNKITVSYFDMAGEKHKVRLKNYEAIVVQHEIDHINGIMFYDHINKENPFALKEGVLVIE-
6 PsiBlast_PDB 80.1352%-100 - C5 -3G6N ? A:[5-191] MITMDDIIREGNPTLREVAKEV--SLP--LSEEDISL--GKEMLEFLKNSQDPIKAEELHLRGGVGLAAPQLDISKRIIAV---H-V---PS---------------------SLST--V-----------------M----YNPKILSHSVQD-A--CLGEGEGCLSVDRE-VPGY---VVRHAKITVSYYDMNGEKHKIRLKNYESIVVQHEIDHINGVMFYDHINDQNPFALKEGVLVIE-
25 PsiBlast_CBE 80.0952%-101 - C5 -3CMD ? B:[10-196] MITMDDIIREGNPTLREVAKEV--SLP--LSEEDISL--GKEMLEFLKNSQDPIKAEELHLRGGVGLAAPQLDISKRIIAV---H-V---PS---------------------SLST--V-----------------M----YNPKILSHSVQD-A--CLGEGEGCLSVDRE-VPGY---VVRHAKITVSYYDMNGEKHKIRLKNYESIVVQHEIDHINGVMFYDHINDQNPFALKEGVLVIE-
10 PsiBlast_PDB 79.8049% -93 - C5 -2OS3 DEF_STRP1 A:[12-203] LITMDDIIREGNPTLRAVAKEV--SLP--LCDEDILL--GEKMMQFLKHSQDPVMAEKLGLRAGVGLAAPQIDVSKRIIAVLVPN-L---P-D-----KE-----GNPPK--EAYSWQEV-----------------L----YNPKIVSHSVQD-A--ALSDGEGCLSVDRV-VEGY---VVRHARVTVDYYDKEGQQHRIKLKGYNAIVVQHEIDHINGVLFYDRINAKNPFETKEELLILD-
7 PsiBlast_PDB 79.7452%-100 - C5 -3CMD ? A:[10-196] MITMDDIIREGNPTLREVAKEV--SLP--LSEEDISL--GKEMLEFLKNSQDPIKAEELHLRGGVGLAAPQLDISKRIIAV---H-V---PS---------------------SLST--V-----------------M----YNPKILSHSVQD-A--CLGEGEGCLSVDRE-VPGY---VVRHAKITVSYYDMNGEKHKIRLKNYESIVVQHEIDHINGVMFYDHINDQNPFALKEGVLVIE-
24 PsiBlast_CBE 78.9652%-100 - C5 -3G6N ? B:[5-191] MITMDDIIREGNPTLREVAKEV--SLP--LSEEDISL--GKEMLEFLKNSQDPIKAEELHLRGGVGLAAPQLDISKRIIAV---H-V---PS---------------------SLST--V-----------------M----YNPKILSHSVQD-A--CLGEGEGCLSVDRE-VPGY---VVRHAKITVSYYDMNGEKHKIRLKNYESIVVQHEIDHINGVMFYDHINDQNPFALKEGVLVIE-
104 HHSearch 78.9153% -97 - C5 -2OS0 DEF_ENTFA A:[1-186] MITMKDIIREGNPTLRAVAEEV--PVP--ITEEDRQL--GEDMLTFLKNSQDPVKAEELQLRGDVGLAAPQLDISKRIIAV---H-V---P----------------------SLST--V-----------------M----YNPKILSHSVQ--DVCL-GEGEGCLSVD-RDVPGY---VVRHNKITVSYFDMAGEKHKVRLKNYEAIVVQHEIDHINGIMFYDHINKENPFALKEGVLVI--
11 PsiBlast_PDB 76.4848% -90 - C5 -3SW8 ? P:[13-203] LIDMNDIIREGNPTLRTVAEEV--TFP--LSDQEIIL--GEKMMQFLKHSQDPVMAEKMGLRGGVGLAAPQLDISKRIIAV---L-VPNI------------------------EAY--D-----------------LEAIMYNPKIVSHSVQD-A--ALGEGEGCLSVDRN-VPGY---VVRHARVTVDYFDKDGEKHRIKLKGYNSIVVQHEIDHINGIMFYDRINEKDPFAVKDGLLILE-
14 PsiBlast_PDB 76.4148% -93 - C5 -2AIE DEF_STRR6 P:[13-203] LIDMCDIIREGNPSLRTVAEEV--TFP--LSDQEIIL--GEKMMQFLKHSQDPVMAEKMGLRGGVGLAAPQLDISKRIIAV---L-VPNI------------------------EAY--D-----------------LEAIMYNPKIVSHSVQD-A--ALGEGEGCLSVDRN-VPGY---VVRHARVTVDYFDKDGEKHRIKLKGYNSIVVQHEIDHINGIMFYDRINEKDPFAVKDGLLILE-
13 PsiBlast_PDB 76.2248% -91 - C5 -2AIA DEF_STRR6 A:[13-203] LIDMCDIIREGNPSLRTVAEEV--TFP--LSDQEIIL--GEKMMQFLKHSQDPVMAEKMGLRGGVGLAAPQLDISKRIIAV---L-VPN--------------------------AY--D-----------------LEAIMYNPKIVSHSVQD-A--ALGEGEGCLSVDRN-VPGY---VVRHARVTVDYFDKDGEKHRIKLKGYNSIVVQHEIDHINGIMFYDRINEKDPFAVKDGLLILE-
12 PsiBlast_PDB 75.3748% -88 - C5 -2AI7 DEF_STRR6 A:[13-203] LIDMCDIIREGNPSLRTVAEEV--TFP--LSDQEIIL--GEKMMQFLKHSQDPVMAEKMGLRGGVGLAAPQLDISKRIIAV---L-VPNI------------------------EAY--D-----------------LEAIMYNPKIVSHSVQD-A--ALGEGEGCLSVDRN-VPGY---VVRHARVTVDYFDKDGEKHRIKLKGYNSIVVQHEIDHINGIMFYDRINEKDPFAVKDGLLILE-
109 HHSearch 66.1435% -98 - C5 -5HGW ? A:[9-175] --MIREILKMGDPRLLEVAKPV--AQF--DTPELHEI--VADMFETMHH------------ANGAGLAAPQIGIGLQIIIF---G-F---G-S-----NNRYPDAP------PVPET--V-----------------L----INPKLEYMPPD--M--E-EGWEGCLSVP-G-MRGV---VSRYAKVRYSGYDQFGAKIDRVAEGFHARVVQHEYDHLIGKLYPMRITDFTRFGFTEVL-----
15 PsiBlast_PDB 64.2132% -88 - C5 -1Y6H DEF_LEPIN A:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
29 PsiBlast_CBE 64.0932% -89 - C5 -1VEV DEF_LEPIN B:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
26 PsiBlast_CBE 64.0432% -84 - C5 -1Y6H DEF_LEPIN B:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
17 PsiBlast_PDB 63.9332% -86 - C5 -1VEV DEF_LEPIN A:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
110 HHSearch 63.5736% -82 - C5 -1Y6H DEF_LEPIN A:[1-170] --SVRKILRMGDPILRKISEPV--TEDEIQTKEFKKL--IRDMFDTMRH------------AEGVGLAAPQIGILKQIVVV---G-S---E-D-----NERYPGTP------DVPER--I-----------------I----LNPVITPLTKD--T--S-GFWEGCLSVP-G-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLD----
16 PsiBlast_PDB 63.4632% -89 - C5 -1SV2 DEF_LEPIN A:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
18 PsiBlast_PDB 63.4432% -86 - C5 -1VEY DEF_LEPIN A:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
28 PsiBlast_CBE 62.8832% -88 - C5 -1VEY DEF_LEPIN B:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
30 PsiBlast_CBE 62.4932% -89 - C5 -1SV2 DEF_LEPIN B:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
27 PsiBlast_CBE 62.3432% -81 - C5 -1VEZ DEF_LEPIN B:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
19 PsiBlast_PDB 62.0632% -84 - C5 -1VEZ DEF_LEPIN A:[1-163] --SVRKILRMGDPILRKISEPVTEDEI--QTKEFKKL--IRDMFDTMRHAE------------GVGLAAPQIGILKQIVVV---G-S---E-DNERYPGT-----P------DVPER--I-----------------I----LNPVITPLTKDT-S--GFW--EGCLSV-PG-MRGY---VERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLF-----------
46 PsiBlast_CBE 60.9733% -88 * C5 *1S17 DEF_PSEAE B:[17-160] -----NILEFPDPRLRTIAKPV--EVV---DDAVRQL--IDDMFETMYEA------------PGIGLAATQVNVHKRIVVM---DLS---E-D-----KS-----E---------PR--V-----------------F----INPEFEPLTEEM-D--QYQ--EGCLSV-----PGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYL-----------------
101 HHSearch 59.8532%-106 - C5 -3U04 ? A:[3-185] -MSVLSIVTVPDKRLSLCSEEV--EK---VDQSIRKL--VDDMFETMHA------------NQGLGLAAVQVGVHKRILVM---N-V---P-E-----E-------IEGYELYGGPY--C-----------------I----INPKIVDISQE--K--V-KLKEGCLSVP-G-YFDY---IVRPQRIAVQYLDYNGNECIIKAQGWLARCLQHEIDHLNGTVFLKYLSKFKRDFAIEKVKKKE-
47 PsiBlast_CBE 59.6333% -83 - C5 -1S17 DEF_PSEAE A:[17-160] -----NILEFPDPRLRTIAKPV--EVV---DDAVRQL--IDDMFETMYEA------------PGIGLAATQVNVHKRIVVM---DLS---E-D-----KS-----E---------PR--V-----------------F----INPEFEPLTEEM-D--QYQ--EGCLSV-----PGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYL-----------------
105 HHSearch 59.4333% -99 - C5 -4WXK DEF_HAEI8 A:[3-159] ---ALNVLIYPDDHLKVVCEPV--TE---VNDAIRKI--VDDMFDTMYQ------------EKGIGLAAPQVDILQRIITI---D-V---E-G-----D-------------KQNQF--V-----------------L----INPEILASEGE-----T-GIEEGCLSIP-G-FRAL---VPRKEKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKL-----
49 PsiBlast_CBE 59.0833% -84 - C5 -1N5N DEF_PSEAE A:[17-160] -----NILEFPDPRLRTIAKPV--EVV---DDAVRQL--IDDMFETMYEA------------PGIGLAATQVNVHKRIVVM---DLS---E-D-----KS-----E---------PR--V-----------------F----INPEFEPLTEEM-D--QYQ--EGCLSV-----PGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYL-----------------
52 PsiBlast_CBE 58.1733% -86 - C5 -1IX1 DEF_PSEAE A:[5-148] -----NILEFPDPRLRTIAKPV--EVV---DDAVRQL--IDDMFETMYEA------------PGIGLAATQVNVHKRIVVM---DLS---E-D-----KS-----E---------PR--V-----------------F----INPEF--EPLTE-D--MDQYQEGCLSV-----PGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYL-----------------
102 HHSearch 57.2536% -73 - C5 -3UWB ? A:[2-150] ---SLKIKTIGDRCLRQKSEEV--EF---DKKEMSEL--YDQMCEAMWA------------SDGIGLAAPQVGINKRVIVV---D-E---T-T-----EE-----H------GKYAH--L-----------------M----VNPKITWKSEE--K--V-LFDEGCLSVP-D-QNGE---VLRPKSIKVTFQNKDGKYKKWKLDGLAARVVQHEIDHLEGILFVDYFN----------------