@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu24280: (2016-07-08 )
MTNKLTSFLADRKKTIENQLSVYTEKLDMPDSLKKSMLYSLQAGGKRLRPLIVLAVLNAYGKSEKDGIPVGCAVEMIHTYSLIHDDLPCMDDDDLRRGKPTNHKVFGEATAVLAGDGLLTESFKLITSHVSDEVSAEKRLRLVNELISAAGTEGMVGGQVADMEAENRQVTLEELESIHERKTAKLLGFCVIAGAILADAPEEDIETLRTFSSHIGIGFQIRDDILDLEGSEEKIGKRVGSDTTNDKSTYPSLLSLEGAKHKLDVHIKEAKRLIGGLSLQKDLLYELCDLIAARDH

Atome Classification :

(56 SA) .........10........20.......-.-.30.-.......40........50...--.....------60..---..--..-..70........80........90........100.......110...--------....-120.......130.......140.......150.....--..160-.....---.--.--170.......180.......190.....-..-.200.-...-....210.......220.......230.......240.......250.......260.......-270......---.---.280.--......290....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTNKLTSFLADRKKTIENQL-SVYTEKL-D-MPDS-LKKSMLYSLQAGGKRLRPLIVL--AVLNA------YGKS---EK--DG-IPVGCAVEMIHTYSLIHDDLPCMDDDDLRRGKPTNHKVFGEATAVLAG--------DGLL-TESFKLITSHVSDEVSAEKRLRLVNELISAAGTEGMVG--GQVAD-MEAEN---R--Q--VTLEELESIHERKTAKLLGFCV-IAGAI-LA-DA-PE-EDI-ETLRTFSSHIGIGFQIRDDILDLEGSEEKIGKRVGSDTTNDKSTYPSLLSLEGAKHKLDVHIKE-AK-RLIGGL---S---LQKDL--LYELCDLIAARDH
1 PsiBlast_PDB 84.6947% -73 - C- -1RTR - ? A:[2-291] -TNLPMNKLIDE---VNNEL-SVAINKS-V-MDTQ-LEESMLYSLNAGGKRIRPVLLL--LTLDS------LNTE---YE--LG-MKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAG--------DALL-TKAFELISS--DDRLTDEVKIKVLQRLSIASGHVGMVG--GQMLD-MQSEG---Q--P--IDLETLEMIHKTKTGALLTFAV-MSAAD-IA-NV-DD-TTK-EHLESYSYHLGMMFQIKDDLLDCYGDEA-------------KSTYVSLLGKDGAEDKLTYHRDA-AV-DELTQI---D---EQFNTKHLLEIVDLFYSR--
89 HHSearch 84.1447% -71 - C- -1RTR - ? A:[7-291] ---------NKLIDEVNNEL-SVAINKS-V-MDTQ-LEESMLYSLNAGGKRIRPVLLL--LTLDS------LNTE---YE--LG-MKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAG--------DALL-TKAFELISSDDR--LTDEVKIKVLQRLSIASGHVGMVG--GQMLD-MQSEG---Q--P--IDLETLEMIHKTKTGALLTFAV-MSAAD-IA-NV-DD-TTK-EHLESYSYHLGMMFQIKDDLLDCYGDEA-------------KSTYVSLLGKDGAEDKLTYHRDA-AV-DELTQI---DEQ-FNTKH--LLEIVDLFYSR--
88 HHSearch 77.6339% -32 - C1 -3PDE ? A:[8-298] ----LIAFEDQWVPALNAPL-KQAILAD-S-QDAQ-LAAAMTYSVLAGGKRLRPLLTV--ATMQS------LGVTFV-PE--RH-WRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLL-TLAFQWLTATDL---PATMQAALVQALATAAGPSGMVA--GQAKD-IQSEH---V--N--LPLSQLRVLHKEKTGALLHYAV-QAGLI-LG-QA-PE-AQW-PAYLQFADAFGLAFQIYDDILDVVSS-----------ADEAKNTYPGKLGLIGANQALIDTIHS-GQ-AALQGL---PTS-TQRDD--LAAFFSYFDTE--
20 PsiBlast_PDB 76.5042% -37 - C1 -3TS7 ? A:[9-300] ----LSDFMRSSQERVERAL-DARLPAA-DRMPER-LHQAMRYSVLGGGKRMRPLLTY--ATGQT------IGVA---ADLLDG---PACAVEFIHVYSLIHDDLPAMDDDDLRRGKPTCHKAYDEATAILAG--------DGLQ-ALAFHVLAQDPSIAVPAENRIAMIETLAKASGPAGMVG--GQAID-LASVG---K--K--LDLPGLENMHIRKTGALIRASVRLACLA-RP-GL-PA-EQF-DRLDHYAKCIGLAFQIQDDILDEESD---------------KPNYPALLGLSGAKEKAEEMHEA-AL-ESLAGF---G---PEADL--LRELARFIIQR--
21 PsiBlast_CBE 76.4243% -34 - C1 -3OAC ? D:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTKSSKELGKTAGKDLVADKTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
7 PsiBlast_PDB 75.7843% -59 - C1 -3KRO ? A:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTK----------------KTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
24 PsiBlast_CBE 75.4543% -33 - C1 -3KRO ? D:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTKSSKELGKTAGKDLVADKTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
25 PsiBlast_CBE 75.0643% -36 - C1 -3KRF ? D:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTKSSKELGKTAGKDLVADKTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
96 HHSearch 74.9339% -95 - C1 -5E8K - GGPPA_ARATH A:[9-303] --FKFMSYMVNKAKSVNKAL-EEAVPLR-E-PELK-IREAMRYTLLSDGKRVRPMLCL--AACEL------VGGQ---ES--TA-MSAACAIEMLHASSLILDDLPCMDNDSLRRGKPTNHIVFGESIAILAS--------QALI-ALAVQKTTSSTFADVPPERILKTVQEMVKAV--EGLVA--GQQAD-LAG-----------TGLEHLEFIHIHKTAALLEAAA-VMGAI-MG-GG-SD-EEI-ERLRSYARCIGLMFQVVDDVLD-------------------KLTYPRLMGVEKSKEYAERLNIE-AR-EHLLGF---DI--DKVAP--LVSLADYIVNR--
6 PsiBlast_PDB 74.8943% -60 - C1 -3KRF ? A:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTK----------------KTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
4 PsiBlast_PDB 74.6743% -57 - C1 -3KRA ? A:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTK----------------KTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
22 PsiBlast_CBE 74.3143% -37 - C1 -3OAB ? D:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTKSSKELGKTAGKDLVADKTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
13 PsiBlast_PDB 73.8545% -77 - C1 -2J1P GGPPS_SINAL A:[37-293] --------------------------------PLK-IHEAMRYSLLAGGKRVRPVLCI--AACEL------VGGE---ES--LA-MPAACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVYGEDVAVLAG--------DALL-SFAFEHLASATSSEVSPARVVRAVGELAKAIGTEGLVA--GQVVD-IS---LDLN--N--VGLEHLKFIHLHKTAALLEASA-VLGGI-IG-GG-SD-EEI-ERLRKFARCIGLLFQVVDDILDV--------------TK--KLTYPKLMGLEKSREFAEKLNTE-ARDQLLGFD---S---DKVAP--LLALANYIANRQN
83 HHSearch 73.5241% -21 - C1 -3TS7 ? A:[7-301] --RSLSDFMRSSQERVERAL-DARLPAA-DRMPER-LHQAMRYSVLGGGKRMRPLLTY--ATGQT------IGVA---AD--LL-DGPACAVEFIHVYSLIHDDLPAMDDDDLRRGKPTCHKAYDEATAILAG--------DGLQ-ALAFHVLAQDPSIAVPAENRIAMIETLAKASGPAGMVG--GQAID-LASVG---K--K--LDLPGLENMHIRKTGALIRASV-RLACL-ARPGL-PA-EQF-DRLDHYAKCIGLAFQIQDDILDEESD---------------KPNYPALLGLSGAKEKAEEMHEA-AL-ESLAGF---G---PEADL--LRELARFIIQRQ-
90 HHSearch 73.3742% -58 - C1 -3M0G - ? A:[3-286] ----LSERLKEVQDAVETAM-AAAIGRL---PAGD-LRDAMAYAA-QGGKRLRAFLAI--ESAAI------HGIS---MA--QA-MPAALAVEALHAYSLVHDDMPCMDNDDLRRGLPTVHKKWDDATAVLAG--------DALQ-TLAFELCTDPVLG--SAENRVALVAALAQASGAEGMVY--GQALD-IAAET---AAVP--LTLDEIIRLQAGKTGALISFAA-QAGAI-LA-GA-DR-----GPLTAYATALGLAFQIADDIL---------------------ATFVSLLGLAGAKSRAADLVAE-AE-AALAPY---G---EAAST--LRACARYVIE---
9 PsiBlast_PDB 73.3543% -64 - C1 -3OAB ? A:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTK----------------KTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
38 PsiBlast_CBE 73.3142% -34 - C1 -3TS7 ? B:[9-300] ----LSDFMRSSQERVERAL-DARLPAA-DRMPER-LHQAMRYSVLGGGKRMRPLLTY--ATGQT------IGVA---ADLLDG---PACAVEFIHVYSLIHDDLPAMDDDDLRRGKPTCHKAYDEATAILAG--------DGLQ-ALAFHVLAQDPSIAVPAENRIAMIETLAKASGPAGMVG--GQAID-LASVG---K--K--LDLPGLENMHIRKTGALIRASVRLACLA-RP-GL-PA-EQF-DRLDHYAKCIGLAFQIQDDILDEESDTQTL-----------KPNYPALLGLSGAKEKAEEMHEA-AL-ESLAGF---G---PEADL--LRELARFIIQR--
27 PsiBlast_CBE 73.0043% -61 - C1 -3KRA ? D:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVT------------------TTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
26 PsiBlast_CBE 72.4843% -63 - C1 -3KRC ? D:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVT------------------TTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
10 PsiBlast_PDB 72.2543% -60 - C1 -3OAC - ? A:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTK----------------KTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
5 PsiBlast_PDB 72.2443% -61 - C1 -3KRC ? A:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTK----------------KTTYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
23 PsiBlast_CBE 70.0643% -51 - C1 -3KRP ? D:[7-295] -------YMLRKAKSVNKAL-EAAVQ-M-K-EPLK-IHESMRYSLLAGGKRVRPMLCI--AACEL------VGGD---ES--TA-MPAACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMAFGESVAVLAG--------DALL-SFAFEHVAA-ATKGAPPERIVRVLGELAVSIGSEGLVA--GQVVD-VCSEG---MA-E--VGLDHLEFIHHHKTAALLQGSV-VLGAI-LG-GG-KE-EEV-AKLRKFANCIGLLFQVVDDILDVTKSSKELGK-----------TYPKLIGVEKSKEFADRLNRE-AQEQLLHFH---P---HRAAP--LIALANYIAYRDN
85 HHSearch 69.5242% -1 - C1 -1RQJ ISPA_ECOLI A:[2-299] ---DFPQQLEACVKQANQAL-SRFIAPLPF-QNTP-VVETMQYGALLGGKRLRPFLVY--ATGHM------FGVS---TN--TL-DAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQ-TLAFSILSDADMPEVSDRDRISMISELASASGIAGMCG--GQALD-LDAEG---K--H--VPLDALERIHRHKTGALIRAAV-RLGAL-SA-GD-KGRRAL-PVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDD-AR-QSLKQL---AEQSLDTSA--LEALADYIIQRNK
48 PsiBlast_CBE 69.0742% 2 - C1 -1RQJ ISPA_ECOLI A:[12-298] -------------KQANQAL-SRFIAPL-P-FQNTPVVETMQYGALLGGKRLRPFLVY--ATGHM------FGVS---TN--TL-DAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQ-TLAFSILSDADMPEVSDRDRISMISELASASGIAGMCG--GQALD-LDAEG---K--H--VPLDALERIHRHKTGALIRAAV-RLGAL-SAGDK-GR-RAL-PVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDD-AR-QSLKQLAEQS---LDTSA--LEALADYIIQRN-
47 PsiBlast_CBE 67.4542% -0 - C1 -1RQJ ISPA_ECOLI B:[12-298] -------------KQANQAL-SRFIAPL-P-FQNTPVVETMQYGALLGGKRLRPFLVY--ATGHM------FGVS---TN--TL-DAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQ-TLAFSILSDADMPEVSDRDRISMISELASASGIAGMCG--GQALD-LDAEG---K--H--VPLDALERIHRHKTGALIRAAV-RLGAL-SAGDK-GR-RAL-PVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDD-AR-QSLKQLAEQS---LDTSA--LEALADYIIQRN-
45 PsiBlast_CBE 66.5042% 0 * C1 *1RQI ISPA_ECOLI B:[13-299] -------------KQANQAL-SRFIAPL-P-FQNTPVVETMQYGALLGGKRLRPFLVY--ATGHM------FGVS---TN--TL-DAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQ-TLAFSILSDADMPEVSDRDRISMISELASASGIAGMCG--GQALD-LDAEG---K--H--VPLDALERIHRHKTGALIRAAV-RLGAL-SAGDK-GR-RAL-PVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDD-AR-QSLKQLAEQS---LDTSA--LEALADYIIQRN-
46 PsiBlast_CBE 65.9142% 2 - C1 -1RQI ISPA_ECOLI A:[13-299] -------------KQANQAL-SRFIAPL-P-FQNTPVVETMQYGALLGGKRLRPFLVY--ATGHM------FGVS---TN--TL-DAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAG--------DALQ-TLAFSILSDADMPEVSDRDRISMISELASASGIAGMCG--GQALD-LDAEG---K--H--VPLDALERIHRHKTGALIRAAV-RLGAL-SAGDK-GR-RAL-PVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDD-AR-QSLKQLAEQS---LDTSA--LEALADYIIQRN-
29 PsiBlast_CBE 64.1644% -6 - C1 -3PDE ? D:[36-286] ------------------------------------LAAAMTYSVLAGGKRLRPLLTV--ATMQS------LGVTFVPER--HW-RPV-MALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLL-TLAFQWLTA---TDLPATMQAALVQALATAAGPSGMVA--GQAKD-IQSEH---V--N--LPLSQLRVLHKEKTGALLHYAV-QAGLI-LG-QA-PE-AQW-PAYLQFADAFGLAFQIYDDILDVVSSPA---------ADEAKNTYPGKLGLIGANQALIDTIHS-GQ-AALQGLPT-S---TQRD----------------
15 PsiBlast_PDB 64.1544% -8 - C1 -3PDE ? A:[36-286] ------------------------------------LAAAMTYSVLAGGKRLRPLLTV--ATMQS------LGVTFVPER--HW-RPV-MALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAG--------DGLL-TLAFQWLTA---TDLPATMQAALVQALATAAGPSGMVA--GQAKD-IQSEH---V--N--LPLSQLRVLHKEKTGALLHYAV-QAGLI-LG-QA-PE-AQW-PAYLQFADAFGLAFQIYDDILDVVSS-----------ADEAKNTYPGKLGLIGANQALIDTIHS-GQ-AALQGLPT-S---TQRD----------------
94 HHSearch 63.5437% -27 - C1 -4LLS ? A:[26-310] ------QRLDAAAAAVQAHF-DKVLAAF-E--PLP-IVEAMAHA-TSGGKRLRGFLVL--ETARL------HDIA---AG--EA-IWSATAIEALHAYSLVHDDLPCMDNDDMRRGQPTVHKKWDDATAVLAG--------DALQ-TLAFELVTHPGAS-ASAEVRADLALSLARASGAQGMVL--GQALD-IAAET---ARAP--LSLDEITRLQQGKTGALIGWSA-QAGAR-LA-QA-DT-----AALKRYAQALGLAFQIADDILDVTGDSAQVGKAVGKDASAGKATFVSLLGLDAARARAMSLIDE-AC-DSLATY---G---AKADT--LRETARFVVRRT-
92 HHSearch 62.7339% 0 - C1 -4LFG ? A:[5-286] ------------LKKIDQTI-HAFYCEKAV-ISEK-LNEAVLYSINAGGKRIRPILFL--EVIEA------LQIPL--TE--SH-FKAAAALEMIHTGSLIHDDLPAMDNDDYRRGQLTNHKKFDEATAILAG--------DSLF-LDAFGMLAETDF---PTDVTVDLVRSLSSASGTFGMVG--GQMLD-MAAEG---K--K--LNLKNLQLIHRHKTGQLLAYPF-WAAAR-VA-QL-DE-NLL-ATFLEIGMIIGLAFQVRDDILDITANFEEIGKTPKKDVMAEKMTYPHLLGLNESYQILDESLDQ-AE-AILRKL---S---DEIAF--APQKILSLIERL-