@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0197: (2016-03-13 )
MQVTDVRLRRVETDGRMRAIASITLDEEFVVHDIRVIDGNNGLFVAMPSKRGVDGEFRDIAHPINSDTRAKIQEVVLAEYERVGEEEATAVTEEESESVSAE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_5(2I9X)
SP5G_STAES
[Raw transfer]




EDO_A_5(2I9X)
SP5G_STAES
[Raw transfer]




EDO_B_6(2I9X)
SP5G_STAES
[Raw transfer]




14 HHSearch 94.7979%-133 - C6 -2IA9 - SP5G_BACSU -
11 PsiBlast_CBE 93.4580%-121 - C6 -2IA9 - SP5G_BACSU -
12 PsiBlast_CBE 93.2680%-125 - C6 -2IA9 - SP5G_BACSU -
1 PsiBlast_PDB 91.9580%-135 - C6 -2IA9 - SP5G_BACSU -
15 HHSearch 85.7070%-150 - C6 -2I9X 2.3 SP5G_STAES
3 PsiBlast_PDB 84.2268%-152 - C6 -2I9X 2.3 SP5G_STAES
2 PsiBlast_PDB 82.5660%-146 - C6 -2I9Z - SP5G_STAES -
13 PsiBlast_CBE 77.0172%-142 - C6 -2I9X 3.2 SP5G_STAES
36 Fugue 45.1316% -63 - C3 -3NSW - ? -
41 Fugue 40.0721% -95 - C5 -1I35 - BYR2_SCHPO -
35 Fugue 37.1015% -23 - C4 -3JTZ - ? -
40 Fugue 35.0617% -1 * C4 *1TTW - ? -
23 HHSearch 34.8514% -23 - C6 -3D0O - LDH1_STAAC -
26 HHSearch 34.4922% -8 - C6 -1EZ4 - LDH_LACPE -
21 HHSearch 33.5918% -25 - C6 -1HYH - DHL2_WEICO -
6 PsiBlast_PDB 33.4634% -14 - C6 -1CVR - -
27 HHSearch 32.9819% -27 - C6 -3TL2 - MDH_BACAN -
16 HHSearch 32.5814% -33 - C6 -1LLD - LDH2_BIFL2 -
7 PsiBlast_PDB 32.5334% -22 - C6 -4IEF - ? -
29 HHSearch 30.5022% -36 - C6 -3WSW - ? -