@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2590: (2016-04-05 )
MLNEQQITRLLYRLQDPVLEASLEETEGVLEVQVLEETANIKIALADPAVETDHFVHNIEELLTQFGVNEINIELEYLPAAVIDRIFQARDNILSEASETKFLAIASGKGGVGKSTVSANLAIALAQQGKKVGLLDADIYGFSIPVLLGTTESPHKENGQIIPVETHGIQMISMDFFVEQGEPVIWRGPMLGKMIKMFLEEVRWGKLDYLLIDLPPGTGDVALDIHTLIPKCNELIVTTPHYAAASVASRAGYMAAKNNHKIIGVIENMSYLTLADGQVLKVFGQGGGEKVAADLETQLLIQLPIEQPEPNGNGYVSALFNSSSTSGKAYKTLAEKIIPYLS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_7(3VX3)
?
[Raw transfer]




ADP_B_10(5AUN)
?
[Raw transfer]




ACP_B_6(5AUO)
?
[Raw transfer]




ACP_I_9(5AUP)
?
[Raw transfer]




ACP_B_6(5AUP)
?
[Raw transfer]




ACP_I_9(5AUP)
?
[Raw transfer]




ADP_B_7(3VX3)
?
[Raw transfer]




1 PsiBlast_PDB 88.2940%-108 - C2 -2PH1 - ? -
144 HHSearch 86.5738% -68 - C2 -2PH1 - ? -
2 PsiBlast_PDB 84.6541%-107 - C2 -3KB1 - ? -
5 PsiBlast_PDB 81.8938%-116 - C3 -5AUO 6.3 ?
6 PsiBlast_PDB 81.3538%-118 - C3 -5AUP 1.8 ?
25 PsiBlast_CBE 81.3238%-122 - C3 -3VX3 5.9 ?
3 PsiBlast_PDB 81.2638%-126 - C3 -3VX3 2.7 ?
7 PsiBlast_PDB 81.2138%-123 - C3 -5AUQ - ? -
4 PsiBlast_PDB 81.0138%-118 - C3 -5AUN 6.0 ?
24 PsiBlast_CBE 80.7738%-117 - C3 -5AUP 6.1 ?
23 PsiBlast_CBE 78.7338%-125 - C3 -5AUQ - ? -
9 PsiBlast_PDB 76.1728% -85 - C3 -1G3R - ? -
8 PsiBlast_PDB 76.0228% -83 * C3 *1G3Q - ? -
139 HHSearch 75.2725% -80 - C2 -1G3Q - ? -
169 Fugue 74.0122% -62 - C2 -3Q9L - MIND_ECOLI -
142 HHSearch 71.8325% -69 - C2 -1HYQ - ? -
143 HHSearch 71.7121% -62 * C2 *3Q9L - MIND_ECOLI -
146 HHSearch 69.1618% -79 - C2 -3FWY - BCHL_RHOS4 -
10 PsiBlast_PDB 67.2227% -77 - C3 -4V03 - ? -
140 HHSearch 67.2021% -66 - C2 -1CP2 - NIFH1_CLOPA -