@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00089_TRYP_P: (2014-08-24 )
FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BEN_A_3(4I8K)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(4I8J)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(4I8L)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(4I8H)
TRY1_BOVIN
[Raw transfer]




0IV_A_2(1ZZZ)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(3T28)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(4I8G)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY5)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY9)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY8)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BYA)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY7)
TRY1_BOVIN
[Raw transfer]




BAM_X_2(2BY6)
TRY1_BOVIN
[Raw transfer]




913_A_10(4ABE)
TRY1_BOVIN
[Raw transfer]




RPR_A_4(1F0U)
TRY1_BOVIN
[Raw transfer]




GOL_C_24(4AOR)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(3T29)
TRY1_BOVIN
[Raw transfer]




SW2_A_8(4ABD)
TRY1_BOVIN
[Raw transfer]




7Z3_A_9(4ABH)
TRY1_BOVIN
[Raw transfer]




PR1_A_5(1F0T)
TRY1_BOVIN
[Raw transfer]




IMA_A_4(1LQE)
TRY1_BOVIN
[Raw transfer]




GHS_A_2(3VPK)
TRY1_BOVIN
[Raw transfer]




GOL_B_16(4AOR)
TRY1_BOVIN
[Raw transfer]




VXQ_A_7(4AB9)
TRY1_BOVIN
[Raw transfer]




GOL_A_13(4ABI)
TRY1_BOVIN
[Raw transfer]




BEN_A_3(1LO6)
KLK6_HUMAN
[Raw transfer]




SW1_A_12(4ABA)
TRY1_BOVIN
[Raw transfer]




PBZ_A_11(2BDG)
KLK4_HUMAN
[Raw transfer]




513_A_8(4ABF)
TRY1_BOVIN
[Raw transfer]




CHAIN_B_2(1YF4)
TRYP_PIG
[Raw transfer]

-

K9S_A_8(4ABB)
TRY1_BOVIN
[Raw transfer]




K7J_A_2(2QXI)
KLK7_HUMAN
[Raw transfer]




CHAIN_B_2(3S9C)
VSPG_DABSI
[Raw transfer]

-

CHAIN_B_2(4ABJ)
TRY1_BOVIN
[Raw transfer]

-

CHAIN_B_2(4ABI)
TRY1_BOVIN
[Raw transfer]

-

MOH_A_6(1FN6)
?
[Raw transfer]




E4B_A_4(3VPK)
TRY1_BOVIN
[Raw transfer]




CHAIN_I_2(4HGC)
TRY1_BOVIN
[Raw transfer]

-

DFP_A_3(2TGD)
TRY1_BOVIN
[Raw transfer]




CHAIN_I_3(1FXY)
TRY1_HUMAN
[Raw transfer]

-

TMO_A_10(3T29)
TRY1_BOVIN
[Raw transfer]




1PE_B_9(4AOQ)
TRY1_BOVIN
[Raw transfer]




CHAIN_B_2(2PSX)
KLK5_HUMAN
[Raw transfer]

-

ACE_B_4(2PSX)
KLK5_HUMAN
[Raw transfer]




CH2_I_5(1FXY)
TRY1_HUMAN
[Raw transfer]




10 PsiBlast_PDB 97.54100%-124 - C1 -1YF4 8.5 TRYP_PIG
15 PsiBlast_PDB 96.3799%-127 - C1 -1FN6 2.8 ?
39 PsiBlast_CBE 92.2282%-126 - C1 -1ZZZ 4.0 TRY1_BOVIN
38 PsiBlast_CBE 92.0982%-126 - C1 -1F0T 5.4 TRY1_BOVIN
37 PsiBlast_CBE 92.0682%-129 - C1 -1F0U 8.3 TRY1_BOVIN
32 PsiBlast_CBE 92.0682%-128 - C1 -2BY8 3.5 TRY1_BOVIN
36 PsiBlast_CBE 92.0382%-128 - C1 -1LQE 7.1 TRY1_BOVIN
71 PsiBlast_CBE 92.0182%-126 - C1 -4AOQ 2.4 TRY1_BOVIN
34 PsiBlast_CBE 91.9482%-127 - C1 -2BY6 3.4 TRY1_BOVIN
83 PsiBlast_CBE 91.9282%-129 - C1 -3T29 3.3 TRY1_BOVIN
81 PsiBlast_CBE 91.9182%-129 - C1 -4AB9 3.1 TRY1_BOVIN
33 PsiBlast_CBE 91.8882%-126 - C1 -2BY7 3.4 TRY1_BOVIN
63 PsiBlast_CBE 91.8782%-127 - C1 -4I8J 3.3 TRY1_BOVIN
67 PsiBlast_CBE 91.7982%-125 - C1 -4AOR 2.3 TRY1_BOVIN
35 PsiBlast_CBE 91.7182%-126 - C1 -2BY5 3.5 TRY1_BOVIN
65 PsiBlast_CBE 91.7082%-126 - C1 -4I8G 3.2 TRY1_BOVIN
75 PsiBlast_CBE 91.6682%-126 - C1 -4ABH 3.9 TRY1_BOVIN
30 PsiBlast_CBE 91.6682%-126 - C1 -2BYA 3.5 TRY1_BOVIN
77 PsiBlast_CBE 91.6382%-127 - C1 -4ABE 3.8 TRY1_BOVIN
64 PsiBlast_CBE 91.5882%-127 - C1 -4I8H 3.3 TRY1_BOVIN
31 PsiBlast_CBE 91.5082%-127 - C1 -2BY9 3.4 TRY1_BOVIN
61 PsiBlast_CBE 91.4782%-127 - C1 -4I8L 3.3 TRY1_BOVIN
84 PsiBlast_CBE 91.4682%-126 - C1 -3T28 3.2 TRY1_BOVIN
82 PsiBlast_CBE 91.4582%-128 - C1 -3VPK 2.9 TRY1_BOVIN
80 PsiBlast_CBE 91.4282%-128 - C1 -4ABA 3.2 TRY1_BOVIN
68 PsiBlast_CBE 91.4182%-123 - C1 -4AOR 2.1 TRY1_BOVIN
62 PsiBlast_CBE 91.4182%-127 - C1 -4I8K 3.2 TRY1_BOVIN
66 PsiBlast_CBE 91.3882%-123 - C1 -4HGC 9.5 TRY1_BOVIN
73 PsiBlast_CBE 91.3082%-125 - C1 -4ABJ 10.0 TRY1_BOVIN
78 PsiBlast_CBE 91.2782%-126 - C1 -4ABD 4.1 TRY1_BOVIN
76 PsiBlast_CBE 91.2682%-126 - C1 -4ABF 3.9 TRY1_BOVIN
74 PsiBlast_CBE 91.2382%-125 - C1 -4ABI 8.9 TRY1_BOVIN
79 PsiBlast_CBE 90.9782%-127 - C1 -4ABB 3.5 TRY1_BOVIN
69 PsiBlast_CBE 90.4882%-120 - C1 -4AOR - TRY1_BOVIN
45 PsiBlast_CBE 87.4682%-120 - C1 -2TGD 2.6 TRY1_BOVIN
97 HHSearch 82.3759%-115 - C1 -1FXY 4.6 TRY1_HUMAN
103 HHSearch 77.0546%-110 * C1 *2PSX 3.6 KLK5_HUMAN
110 HHSearch 76.5643%-114 - C1 -2QXI 4.4 KLK7_HUMAN
98 HHSearch 75.3047%-110 - C1 -1LO6 2.9 KLK6_HUMAN
111 HHSearch 73.1342%-112 - C1 -3S9C 1.3 VSPG_DABSI
106 HHSearch 72.8140%-110 - C1 -2BDG 3.0 KLK4_HUMAN