@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : trmd_haein_: (2014-06-20 )
MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

21X_A_3(4MCC)
TRMD_HAEIN
[Raw transfer]




SAH_E_5(1UAM)
TRMD_HAEIN
[Raw transfer]




SAH_A_2(1P9P)
TRMD_ECOLI
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




21X_A_3(4MCC)
TRMD_HAEIN
[Raw transfer]




LIG_A_2(U059)

[Raw transfer]

-

LIG_A_2(U055)

[Raw transfer]

-

SAH_A_3(4H3Y)
TRMD_BURP8
[Raw transfer]




LIG_A_2(U054)

[Raw transfer]

-

ADN_A_2(3AXZ)
TRMD_HAEIN
[Raw transfer]




LIG_A_2(U050)

[Raw transfer]

-

SAH_A_3(4H3Z)
TRMD_BURP8
[Raw transfer]




SAH_A_3(4H3Z)
TRMD_BURP8
[Raw transfer]




LIG_A_2(U053)

[Raw transfer]

-

21W_B_8(4MCB)
TRMD_HAEIN
[Raw transfer]




21X_B_4(4MCC)
TRMD_HAEIN
[Raw transfer]




21W_A_5(4MCB)
TRMD_HAEIN
[Raw transfer]




LIG_A_2(U052)

[Raw transfer]

-

LIG_A_2(U057)

[Raw transfer]

-

LIG_A_2(U058)

[Raw transfer]

-

GOL_A_3(4MCB)
TRMD_HAEIN
[Raw transfer]




445_A_2(U048)

[Raw transfer]

-

LIG_A_2(U056)

[Raw transfer]

-

445_A_2(U049)

[Raw transfer]

-

22L_A_2(4MCD)
TRMD_HAEIN
[Raw transfer]




22L_A_2(4MCD)
TRMD_HAEIN
[Raw transfer]




LIG_A_2(U051)

[Raw transfer]

-

LIG_A_2(U060)

[Raw transfer]

-

21W_A_5(4MCB)
TRMD_HAEIN
[Raw transfer]




LIG_B_3(U060)

[Raw transfer]

-

EDO_A_3(3QUV)
?
[Raw transfer]




EDO_A_4(3QUV)
?
[Raw transfer]




FLC_C_4(U059)

[Raw transfer]

-

FLC_C_4(U050)

[Raw transfer]

-

3 PsiBlast_PDB 99.41100%-138 - C1 -1UAL 7.0 TRMD_HAEIN
18 Fugue 99.3199%-138 - C1 -1UAL 7.0 TRMD_HAEIN
28 HHSearch 98.68100%-138 - C1 -1UAL 7.0 TRMD_HAEIN
2 PsiBlast_PDB 97.99100%-136 - C1 -1UAK - TRMD_HAEIN
27 HHSearch 97.94100%-136 - C1 -4MCD 6.0 TRMD_HAEIN
7 PsiBlast_PDB 97.94100%-136 - C1 -4MCD 6.0 TRMD_HAEIN
8 PsiBlast_PDB 97.92100%-138 - C1 -3AXZ 6.1 TRMD_HAEIN
1 PsiBlast_PDB 97.74100%-135 - C1 -1UAJ - TRMD_HAEIN
4 PsiBlast_PDB 97.37100%-129 - C1 -1UAM 7.5 TRMD_HAEIN
17 PsiBlast_CBE 97.32100%-128 - C1 -4MCB 7.0 TRMD_HAEIN
16 PsiBlast_CBE 97.16100%-136 - C1 -4MCC 6.6 TRMD_HAEIN
9 PsiBlast_PDB 93.8383%-134 - C1 -1P9P 7.1 TRMD_ECOLI
6 PsiBlast_PDB 86.59100%-140 - C1 -4MCC 6.7 TRMD_HAEIN
5 PsiBlast_PDB 86.04100%-138 - C1 -4MCB 6.9 TRMD_HAEIN
29 HHSearch 83.5853%-131 - C1 -4H3Z 7.5 TRMD_BURP8
10 PsiBlast_PDB 80.8454%-129 - C1 -4H3Y 7.0 TRMD_BURP8
11 PsiBlast_PDB 80.4854%-129 - C1 -4H3Z 7.5 TRMD_BURP8
15 PsiBlast_PDB 72.7642%-134 - C1 -3QUV 3.1 ?
33 HHSearch 72.1244%-114 - C1 -3IEF - TRMD_BARHE
34 HHSearch 71.9244%-122 * C1 *3QUV - ?


Add PDB User Result:

(13 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

21X_A_3(4MCC)
TRMD_HAEIN
[Raw transfer]




SAH_E_5(1UAM)
TRMD_HAEIN
[Raw transfer]




SAH_A_2(1P9P)
TRMD_ECOLI
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




21X_A_3(4MCC)
TRMD_HAEIN
[Raw transfer]




LIG_A_2(U059)

[Raw transfer]

-

LIG_A_2(U055)

[Raw transfer]

-

SAH_A_3(4H3Y)
TRMD_BURP8
[Raw transfer]




LIG_A_2(U054)

[Raw transfer]

-

ADN_A_2(3AXZ)
TRMD_HAEIN
[Raw transfer]




LIG_A_2(U050)

[Raw transfer]

-

SAH_A_3(4H3Z)
TRMD_BURP8
[Raw transfer]




SAH_A_3(4H3Z)
TRMD_BURP8
[Raw transfer]




LIG_A_2(U053)

[Raw transfer]

-

21W_B_8(4MCB)
TRMD_HAEIN
[Raw transfer]




21X_B_4(4MCC)
TRMD_HAEIN
[Raw transfer]




21W_A_5(4MCB)
TRMD_HAEIN
[Raw transfer]




LIG_A_2(U052)

[Raw transfer]

-

LIG_A_2(U057)

[Raw transfer]

-

LIG_A_2(U058)

[Raw transfer]

-

GOL_A_3(4MCB)
TRMD_HAEIN
[Raw transfer]




445_A_2(U048)

[Raw transfer]

-

LIG_A_2(U056)

[Raw transfer]

-

445_A_2(U049)

[Raw transfer]

-

22L_A_2(4MCD)
TRMD_HAEIN
[Raw transfer]




22L_A_2(4MCD)
TRMD_HAEIN
[Raw transfer]




LIG_A_2(U051)

[Raw transfer]

-

LIG_A_2(U060)

[Raw transfer]

-

21W_A_5(4MCB)
TRMD_HAEIN
[Raw transfer]




LIG_B_3(U060)

[Raw transfer]

-

EDO_A_3(3QUV)
?
[Raw transfer]




EDO_A_4(3QUV)
?
[Raw transfer]




FLC_C_4(U059)

[Raw transfer]

-

FLC_C_4(U050)

[Raw transfer]

-

48 -99%-118 - C1 -U048 4.5
49 -99%-118 - C1 -U049 4.5
50 -99%-113 - C1 -U050 4.9
51 -99%-119 - C1 -U051 4.4
52 -99%-117 - C1 -U052 4.5
53 -99%-119 - C1 -U053 5.4
54 -99%-116 - C1 -U054 6.1
55 -99%-110 - C1 -U055 6.4
56 -99%-113 - C1 -U056 7.0
57 -99% -70 - C1 -U057 7.6
58 -99%-111 - C1 -U058 4.7
59 -99%-109 - C1 -U059 6.1
60 -99%-111 - C1 -U060 8.4