@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Wbm0789: (2015-12-04 )
MHKFAILFSILLAIVAYHLNNEVAFEVARLFSGIFISLLKLISLPLVFLSIVSTISGLKDSIEIKTLVKKTLFYTLLTTIIAAFVALSFYLLIDPVRKNFISNTIESASNSNYNYFSYLKLLIPSNFMQVFLKNNTIGSILIAFLMGRAIISLPKGKQDILHQVFSALFDTLLKIAQWLLKFIPLAVWSFITCFLHELKGGSEFYSLLWYFACIMSANSVQAFLILPLLMWCKGISPIQTLRGVMPALTLAFFSKSSSATLPTTIDCVQNKLKVPKKLSSFILPICTTINMNACATFILITVMFVAEMNGCTFSLSEIFIWIFLATGAAIGNAGVPMGCYFMATSYLVSMNVPLYIMGLILPIYTIIDMFETAINVWSDVCVTQIINKEYKGEI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ASP_A_4(3KBC)
?
[Raw transfer]




11 PsiBlast_PDB 95.7425%-161 - C4 -3KBC 3.6 ?
2 PsiBlast_PDB 95.6425%-167 - C4 -3V8G - ? -
16 PsiBlast_PDB 95.5725%-167 - C4 -4P3J - ? -
35 Fugue 94.9926%-165 - C4 -4OYF - ? -
15 PsiBlast_PDB 94.7125%-165 - C4 -4P1A - ? -
5 PsiBlast_PDB 94.7125%-160 - C4 -2NWW - ? -
10 PsiBlast_PDB 94.4824%-163 - C4 -3V8F - ? -
14 PsiBlast_PDB 94.4725%-168 - C4 -4P19 - ? -
13 PsiBlast_PDB 94.2525%-169 - C4 -4X2S - ? -
17 PsiBlast_PDB 93.1625%-162 - C4 -4P6H - ? -
24 HHSearch 92.9525%-168 - C4 -2NWL - ? -
4 PsiBlast_PDB 92.9125%-156 - C4 -1XFH - ? -
1 PsiBlast_PDB 92.3927%-159 - C4 -4KY0 - ? -
7 PsiBlast_PDB 92.3225%-158 - C4 -4OYF - ? -
3 PsiBlast_PDB 92.2425%-154 - C4 -4OYG - ? -
6 PsiBlast_PDB 91.6825%-155 - C4 -2NWX - ? -
8 PsiBlast_PDB 90.9725%-160 - C4 -2NWL - ? -
9 PsiBlast_PDB 90.7025%-160 - C4 -4OYE - ? -
12 PsiBlast_PDB 90.4125%-154 - C4 -4IZM - ? -
34 Fugue 90.0624%-157 - C4 -1XFH - ? -