@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : SA1453: (2016-03-25 )
MKISTKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRGAKGGYQLRVPAEEISAGDIIRLLEGPITFVESIESEPPAQKQLWIRMRDAVRDVLDNTTLKYLAEYVDTSEDLDGYMFYI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_Q_3(4CIC)
?
[Raw transfer]

-

CHAIN_Q_3(4CIC)
?
[Raw transfer]

-

1 PsiBlast_PDB 92.56100%-119 - C3 -3T8R - ? -
27 HHSearch 89.3664%-131 - C3 -3LWF - ? -
24 PsiBlast_CBE 88.9367%-124 - C3 -2Y75 - CYMR_BACSU -
25 PsiBlast_CBE 88.8067%-144 - C- -2Y75 - CYMR_BACSU -
23 PsiBlast_CBE 88.6167%-128 - C3 -2Y75 - CYMR_BACSU -
21 PsiBlast_CBE 88.3467%-127 - C3 -2Y75 - CYMR_BACSU -
22 PsiBlast_CBE 87.0767%-124 - C3 -2Y75 - CYMR_BACSU -
3 PsiBlast_PDB 87.0762%-128 - C3 -3LWF - ? -
4 PsiBlast_PDB 85.7167%-128 - C3 -2Y75 - CYMR_BACSU -
28 HHSearch 85.3167%-128 - C3 -2Y75 - CYMR_BACSU -
48 Fugue 85.0259%-132 - C3 -3LWF - ? -
26 PsiBlast_CBE 77.3144%-117 - C3 -4CIC 2.9 ?
5 PsiBlast_PDB 76.8144%-114 - C3 -4CIC 3.6 ?
9 PsiBlast_PDB 70.7933%-118 - C3 -4CHU - ? -
8 PsiBlast_PDB 70.5432%-125 - C3 -4HF0 - ISCR_ECOLI -
6 PsiBlast_PDB 69.7332%-118 - C3 -4HF1 - ISCR_ECOLI -
7 PsiBlast_PDB 69.6832%-119 - C3 -4HF2 - ISCR_ECOLI -
2 PsiBlast_PDB 69.0299% -17 - C3 -3T8T - ? -
30 HHSearch 56.7115%-112 - C3 -3K69 - ? -
29 HHSearch 54.8115%-109 - C3 -1XD7 - YWNA_BACSU -