@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0251: (2016-03-13 )
MALNIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVAVAAAGGAAAEQTEFTVELASAGDSKIKVIKVVREITGLGLKEAKELVDNAPKALKEGIAKDEAEEIKAKLEEVGANVEVK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TBR_A_5(1DD4)
?
[Raw transfer]




TBR_A_6(1DD4)
?
[Raw transfer]




22 HHSearch 94.6864% -88 - C2 -1DD3 - RL7_THEMA -
6 PsiBlast_PDB 93.8860% -99 - C2 -1DD3 - RL7_THEMA -
35 Fugue 93.6963% -89 - C2 -1DD3 - RL7_THEMA -
18 PsiBlast_CBE 91.8060% -98 - C2 -1DD4 5.5 ?
7 PsiBlast_PDB 91.5460% -98 - C2 -1DD4 4.9 ?
2 PsiBlast_PDB 85.8258% -74 - C2 -1RQV - RL7_ECOLI -
1 PsiBlast_PDB 83.9058% -79 - C2 -1RQU - RL7_ECOLI -
23 HHSearch 78.9664% -94 - C2 -1CTF - RL7_ECOLI -
4 PsiBlast_PDB 78.9664% -94 - C2 -1CTF - RL7_ECOLI -
38 Fugue 77.7667% -97 - C2 -1DD3 - RL7_THEMA -
3 PsiBlast_PDB 75.9364% -80 - C2 -1RQS - RL7_ECOLI -
43 Fugue 54.6520% -43 - C1 -1YOZ - Y941_ARCFU -
28 HHSearch 51.9216% -50 - C2 -2W9R - CLPS_ECOLI -
27 HHSearch 51.6317% -64 - C2 -3O1F - CLPS_ECOLI -
21 HHSearch 49.6132% 115 - C- -2FTC - RM12_BOVIN -
8 PsiBlast_PDB 48.4329% 106 - C- -2FTC - RM12_BOVIN -
13 PsiBlast_PDB 48.1931% -22 - C2 -1BVU - DHE3_THELN -
32 HHSearch 40.4032% -5 - C2 -1AIP - EFTS_THET8 -
16 PsiBlast_PDB 39.9730% 9 - C2 -4IS2 - BAIA2_CLOSV -
15 PsiBlast_PDB 39.4630% -0 - C2 -3RHD - LADH_METJA -