@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0359: (2016-03-14 )
MLYTMKDLLAVGKEHQFAVPAFNICSFDMLKAIMEEVEANNAPVILEIHPDEIEYLGDNFVATVREYAYRSKVPVVIHMDHGGTIKDVMRAIRNGYTSVMIDASRASYEENVALTTQVVELAHKVGVSVEAELGTIGNNGSAEGGADTIIYTDPDQAEDFVSRTGIDTLAVAIGTAHGLYPKDKKPELNMPLLKELNKRLDIPFVLHGGSGNPDKEVSESVQYGVRKVNLSSDLKSVFFEEVRRVLVDNPAMYEPNQVYPSANEKVKDVVRHKLDILNTTGQADKY

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGH_A_4(2ISW)
?
[Raw transfer]




PGH_B_12(1GVF)
KBAY_ECOLI
[Raw transfer]




PGH_A_3(1GVF)
KBAY_ECOLI
[Raw transfer]




PGH_A_3(1GVF)
KBAY_ECOLI
[Raw transfer]




13P_A_5(2FJK)
ALF_THECA
[Raw transfer]




PGH_A_4(2ISW)
?
[Raw transfer]




PGH_A_5(2ISV)
?
[Raw transfer]




PGH_B_6(2ISV)
?
[Raw transfer]




13P_A_8(3Q94)
?
[Raw transfer]




PGH_A_9(3C52)
ALF_HELPY
[Raw transfer]




FLC_B_6(4TO8)
?
[Raw transfer]




FLC_A_4(4TO8)
?
[Raw transfer]




34 PsiBlast_CBE 95.3133%-100 - C3 -3C56 - ALF_HELPY -
7 PsiBlast_PDB 95.0833% -98 - C3 -3N9R - ? -
31 PsiBlast_CBE 94.8533% -98 - C3 -3N9R - ? -
30 PsiBlast_CBE 94.7533% -95 - C3 -3N9R - ? -
28 PsiBlast_CBE 94.4833% -97 - C3 -3N9S - ? -
32 PsiBlast_CBE 94.4433% -95 - C3 -3N9R - ? -
29 PsiBlast_CBE 94.1933% -97 - C3 -3N9R - ? -
35 PsiBlast_CBE 94.1833% -98 - C3 -3C4U - ALF_HELPY -
33 PsiBlast_CBE 94.0533% -95 - C3 -3N9R - ? -
5 PsiBlast_PDB 93.7633% -95 - C3 -3C52 4.1 ALF_HELPY
4 PsiBlast_PDB 93.6733%-100 - C3 -3C4U - ALF_HELPY -
41 HHSearch 93.5135%-102 - C3 -1GVF 3.8 KBAY_ECOLI
6 PsiBlast_PDB 93.3233% -97 - C3 -3C56 - ALF_HELPY -
27 PsiBlast_CBE 93.2834%-100 - C3 -1RV8 - ? -
23 PsiBlast_CBE 93.2334% -98 - C3 -1RVG - ? -
25 PsiBlast_CBE 92.9134% -98 - C3 -1RV8 - ? -
26 PsiBlast_CBE 92.8534% -96 - C3 -1RV8 - ? -
22 PsiBlast_CBE 92.5734% -95 - C3 -1RVG - ? -
24 PsiBlast_CBE 92.4934% -98 - C3 -1RVG - ? -
39 HHSearch 92.4037% -85 - C3 -1RVG - ? -
8 PsiBlast_PDB 91.7034% -89 - C3 -2FJK 4.1 ALF_THECA
36 PsiBlast_CBE 91.2836% -92 - C3 -1GVF 4.0 KBAY_ECOLI
9 PsiBlast_PDB 89.8736% -95 - C3 -1GVF 3.8 KBAY_ECOLI
13 PsiBlast_PDB 88.7634% -83 - C3 -3Q94 4.4 ?
21 PsiBlast_CBE 88.3437% -87 - C3 -4TO8 4.1 ?
1 PsiBlast_PDB 88.2637% -87 - C3 -4TO8 3.8 ?
38 PsiBlast_CBE 86.4931% -86 - C3 -2ISV 4.3 ?
11 PsiBlast_PDB 86.2731% -90 - C3 -2ISV 3.2 ?
40 HHSearch 85.9834% -90 * C3 *2ISW 4.1 ?
12 PsiBlast_PDB 83.7131% -89 - C3 -2ISW 4.1 ?