@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1604: (2016-03-26 )
VAERLVGTQAPRFEMEAVMPNQTFGKVSLEKNIEDDKWTILFFYPMDFTFVCPTEIVAISARSDEFDALNARIIGASTDTIHSHLAWTNTPIKEGGIGKLNYPLAADTNHQVASDYGVLIEEEGVALRGLFIINPKGEIQYEVVHHNNIGREVDEVLRVLQALQTGGLCPINWQPGEKTIV

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEG_E_14(4K1F)
?
[Raw transfer]



PEG_D_12(4K1F)
?
[Raw transfer]



PGE_A_6(4K1F)
?
[Raw transfer]



PEG_B_8(4K1F)
?
[Raw transfer]



PEG_C_10(4K1F)
?
[Raw transfer]



ACY_A_4(3VWV)
PRDX4_MOUSE
[Raw transfer]
25 PsiBlast_CBE 94.4451%-126 - C1 -3SBC - TSA1_YEAST -
31 PsiBlast_CBE 94.0451%-123 - C1 -3SBC - TSA1_YEAST -
11 PsiBlast_PDB 93.9847%-122 - C1 -1QMV - PRDX2_HUMAN -
24 PsiBlast_CBE 93.8951%-122 - C1 -3SBC - TSA1_YEAST -
28 PsiBlast_CBE 93.4451%-119 - C1 -3SBC - TSA1_YEAST -
26 PsiBlast_CBE 93.1651%-125 - C1 -3SBC - TSA1_YEAST -
7 PsiBlast_PDB 92.9651%-127 - C1 -3SBC - TSA1_YEAST -
29 PsiBlast_CBE 92.6451%-120 - C1 -3SBC - TSA1_YEAST -
27 PsiBlast_CBE 92.3451%-122 - C1 -3SBC - TSA1_YEAST -
112 HHSearch 92.0053%-120 - C1 -3SBC - TSA1_YEAST -
30 PsiBlast_CBE 90.5351%-117 - C1 -3SBC - TSA1_YEAST -
6 PsiBlast_PDB 90.5347%-112 - C1 -3HY2 - PRDX1_HUMAN -
5 PsiBlast_PDB 90.5049%-124 - C1 -4LLR - ? -
38 PsiBlast_CBE 90.2945%-122 - C1 -4K1F 1.9 ?
4 PsiBlast_PDB 90.1948%-120 - C1 -2Z9S - PRDX1_RAT -
36 PsiBlast_CBE 90.0045%-117 - C1 -4K1F 2.0 ?
21 PsiBlast_CBE 89.9549%-118 - C1 -1QQ2 - PRDX1_RAT -
35 PsiBlast_CBE 89.6845%-120 - C1 -4K1F 3.2 ?
1 PsiBlast_PDB 89.5549%-117 - C1 -1QQ2 - PRDX1_RAT -
12 PsiBlast_PDB 89.0545%-118 - C1 -4K1F 1.7 ?
37 PsiBlast_CBE 88.8545%-122 - C1 -4K1F 1.9 ?
17 PsiBlast_PDB 78.9844%-117 - C1 -3VWV 3.0 PRDX4_MOUSE