@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1724: (2016-03-28 )
MNENLITITGLTKKYRKRKPLNDINLSLQKGKIIGLLGPNGAGKTTLLNAISGLLKPTSGTINLAENSKIAYLPSEDFLPNMVICDYFRIYHSFFPDFDQEKAKQMIRSFGINIKENTKYLSKGNAAKVMLALILCRDVDLYLLDEPFSEIDLISRDDLIKSIATFLKEDATLVVTTHLIQDMEMMFDEIIFLKRGKIIEQIDTETLREEYRKSVMDYYREVFGHA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_3(4QC2)
?
[Raw transfer]




ADP_A_3(4P32)
LPTB_ECOLI
[Raw transfer]




ADP_A_3(4P31)
LPTB_ECOLI
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




1 PsiBlast_PDB 90.6631%-122 - C1 -1VPL - ? -
47 HHSearch 90.3032%-123 - C1 -1VPL - ? -
2 PsiBlast_PDB 87.6029%-137 - C1 -2IT1 - ? -
6 PsiBlast_PDB 84.1830%-114 - C1 -1OXV - ? -
37 HHSearch 83.2927%-115 - C1 -1OXX - ? -
11 PsiBlast_PDB 83.2030%-115 - C1 -1OXX - ? -
35 HHSearch 83.1828%-119 - C1 -3D31 - ? -
4 PsiBlast_PDB 83.0430%-117 - C1 -1OXT - ? -
5 PsiBlast_PDB 82.4130%-114 - C1 -1OXU - ? -
3 PsiBlast_PDB 82.3930%-113 - C1 -1OXS - ? -
54 Fugue 81.9724%-109 - C1 -1Z47 - ? -
33 HHSearch 81.9727%-122 - C1 -2IT1 - ? -
44 HHSearch 81.8525%-124 - C1 -1B0U - HISP_SALTY -
28 HHSearch 80.9925%-116 - C1 -1Z47 - ? -
36 HHSearch 80.7725%-122 - C1 -2YYZ - ? -
14 PsiBlast_PDB 80.3829%-138 - C1 -1V43 - ? -
13 PsiBlast_PDB 80.2029%-135 - C1 -1VCI 4.4 ?
41 HHSearch 80.1323%-123 - C1 -2OLJ - ? -
42 HHSearch 79.5424%-124 - C1 -3GFO - ECFA3_CLOP1 -
16 PsiBlast_PDB 79.2223%-118 - C1 -4RVC - ? -