@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1900: (2016-03-29 )
MFRTMMNGKIHRATVTEANLNYVGSITIDSAILEAVDMLPNEKVQIVNNNNGARIETYIIPGEPGSGVICLNGAAARHVQVGDVVIIMSYGMFTDEEAKTHEPKIVVLDEKNHIEMILPEEKAHTTL

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEG_B_4(3PLX)
PAND_CAMJE
[Raw transfer]




FMR_B_4(2EEO)
?
[Raw transfer]




NSN_A_9(1UHE)
?
[Raw transfer]




NSN_A_9(1UHE)
?
[Raw transfer]




GOL_C_14(3OUG)
PAND_FRATT
[Raw transfer]




PEG_B_4(3PLX)
PAND_CAMJE
[Raw transfer]




NSN_A_9(1UHE)
?
[Raw transfer]




NSN_A_9(1UHE)
?
[Raw transfer]




FMR_B_4(2EEO)
?
[Raw transfer]




CHAIN_D_3(1AW8)
?
[Raw transfer]

-

CHAIN_A_1(3PLX)
?
[Raw transfer]

-

CHAIN_A_1(3PLX)
?
[Raw transfer]

-

22 PsiBlast_CBE 94.3145%-132 - C3 -1PYQ - PAND_ECOLI -
23 PsiBlast_CBE 94.0145%-130 - C3 -1PT1 - PAND_ECOLI -
8 PsiBlast_PDB 92.4745%-122 - C3 -1PT1 - PAND_ECOLI -
7 PsiBlast_PDB 92.3245%-129 - C3 -1PYQ - PAND_ECOLI -
1 PsiBlast_PDB 92.0754%-115 - C3 -2C45 - PAND_MYCTU -
9 PsiBlast_PDB 91.7445%-130 - C3 -1PT0 - PAND_ECOLI -
3 PsiBlast_PDB 91.7445%-129 - C3 -1PQE - PAND_ECOLI -
53 HHSearch 91.6750%-131 - C- -2C45 - PAND_MYCTU -
21 PsiBlast_CBE 90.8345%-120 - C3 -4AZD - ? -
10 PsiBlast_PDB 90.6850%-141 - C3 -3OUG - PAND_FRATT -
2 PsiBlast_PDB 90.3445%-122 - C3 -4CS0 - PAND_ECOLI -
55 HHSearch 90.3348%-143 * C3 *3OUG Error PAND_FRATT
6 PsiBlast_PDB 90.2245%-124 - C3 -4AZD - ? -
4 PsiBlast_PDB 89.7645%-125 - C3 -4CRZ - ? -
18 PsiBlast_PDB 78.9041%-134 - C3 -3TM7 - ? -
58 HHSearch 77.5246%-140 - C3 -1UHE 2.5 ?
12 PsiBlast_PDB 77.1250%-135 - C3 -2EEO 3.9 ?
14 PsiBlast_PDB 76.8048%-143 - C3 -1UHE 2.5 ?
27 PsiBlast_CBE 76.7641%-140 - C3 -3TM7 - ? -
17 PsiBlast_PDB 76.0741%-136 - C3 -4CRY - ? -
5 PsiBlast_PDB 56.9056% -21 - C3 -3PLX 12.2 ?
57 HHSearch 55.0456% -20 - C3 -3PLX 12.4 ?
78 Fugue 15.4558% 55 - C3 -3PLX Error PAND_CAMJE
61 HHSearch 14.5258% 62 - C3 -3PLX Error PAND_CAMJE
77 Fugue 13.8365% 62 - C3 -2EEO Error ?
76 Fugue 12.8645% 66 - C3 -1AW8 Error ?
80 Fugue 12.6762% 60 - C3 -1UHE Error ?
59 HHSearch 11.5763% 75 - C3 -1UHE Error ?