@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo2114: (2016-04-01 )
METVLQAKNVRKIYGSKGNVYTALENISIDIKEGEFTGIMGPSGAGKSTLLNVLSTIDKPTSGQIVISGQELENMNEQQMSTFRRDKLGFIFQDYNLLDTLTIRENIILPLALAKRPVKEMEEKLAIISEKFGITEILDKYPSEISGGQKQRTAASRAIITSPSLIFADEPTGALDSKSATNLLESLRDLNEQDKSTIMMVTHDAFAASFCKRILFIKDGELYTEIYRGTKTRKEFFQKILDVLAKLGGDSDDVI

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_A_3(1F3O)
Y796_METJA
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




POP_A_9(2D62)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




92 HHSearch 92.2441% -89 - C1 -3TIF - Y796_METJA -
1 PsiBlast_PDB 91.3242% -89 - C1 -1L2T - Y796_METJA -
21 PsiBlast_CBE 89.3042% -87 - C1 -1L2T 6.7 Y796_METJA
3 PsiBlast_PDB 89.1242% -83 - C1 -1F3O 7.1 Y796_METJA
22 PsiBlast_CBE 88.8841% -87 - C1 -3TIF 6.3 Y796_METJA
2 PsiBlast_PDB 88.3841% -86 - C1 -3TIF - Y796_METJA -
96 Fugue 88.3633% -98 - C1 -3TUZ - METN_ECOLI -
89 HHSearch 87.3741% -87 - C1 -2PCJ - LOLD_AQUAE -
4 PsiBlast_PDB 85.7239% -87 - C1 -2PCJ - LOLD_AQUAE -
7 PsiBlast_PDB 85.5033%-101 - C1 -3TUI - METN_ECOLI -
23 PsiBlast_CBE 85.2339% -88 - C1 -2PCJ - LOLD_AQUAE -
8 PsiBlast_PDB 85.1933%-103 - C1 -3TUZ - METN_ECOLI -
25 PsiBlast_CBE 84.6133% -97 - C1 -3TUZ - METN_ECOLI -
35 PsiBlast_CBE 84.0935% -96 - C1 -4YMU 5.1 ?
29 PsiBlast_CBE 84.0233% -99 - C1 -3TUI - METN_ECOLI -
13 PsiBlast_PDB 83.4535% -95 - C1 -4YMS - ? -
24 PsiBlast_CBE 83.4333%-100 - C1 -3TUZ - METN_ECOLI -
15 PsiBlast_PDB 83.3535% -97 - C1 -4YMU 5.3 ?
5 PsiBlast_PDB 83.2739% -84 - C1 -2PCL - LOLD_AQUAE -
16 PsiBlast_PDB 83.2135% -93 - C1 -4YMV 5.3 ?
34 PsiBlast_CBE 83.1935% -93 - C1 -4YMV 4.4 ?
11 PsiBlast_PDB 81.0232% -87 - C1 -4U00 6.5 ?
18 PsiBlast_PDB 71.9436% -85 - C1 -2D62 3.0 ?
56 PsiBlast_CBE 69.1033% -85 - C1 -2OLJ 5.2 ?
51 PsiBlast_CBE 68.7633% -78 - C1 -2OLK 5.2 ?
20 PsiBlast_PDB 68.3831% -99 - C1 -1VCI 4.2 ?
53 PsiBlast_CBE 68.3333% -78 - C1 -2OLK 5.3 ?
52 PsiBlast_CBE 67.5533% -77 - C1 -2OLK 5.4 ?
54 PsiBlast_CBE 67.4533% -78 - C1 -2OLK 5.1 ?
58 PsiBlast_CBE 66.6433% -78 - C1 -3C41 5.3 ?
43 PsiBlast_CBE 66.1233% -83 - C1 -3C4J 4.3 ?
44 PsiBlast_CBE 65.7933% -74 - C1 -3C4J 5.9 ?
59 PsiBlast_CBE 65.4733% -75 - C1 -3C41 6.1 ?
45 PsiBlast_CBE 64.5033% -75 - C1 -2Q0H 5.3 ?
46 PsiBlast_CBE 64.0133% -76 - C1 -2Q0H 4.7 ?
55 PsiBlast_CBE 63.2333% -72 - C1 -2OLJ 5.3 ?