@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0042: (2015-11-27 )
MKLLVVGSGGREHAIAKKLLASKDVDQVFVAPGNDGMTLDGLDLVNIGISEHSRLIDFAKENEIAWTFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSKDFAKEIMVKYNVPTAAYGTFSDFEKAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQAVEAAQEMLLDNKFGDSGARVVIEEFLDGEEFSLFAFANGDKFYIMPTAQDHKRAFDGDKGPNTGGMGAYAPVPHLPQSVVDTAVETIIKPVLEGMIAEGRPYLGVLYAGLILTADGPKVIEFNSRFGDPETQIILPRLTSDFAQNIDDIMMGIEPYITWQKDGVTLGVVVASEGYPLDYEKGVPLPEKTDGDIITYYAGAKFAENSKALLSNGGRVYMLVTTEGSVKAGQDKIYTQLAQQDTTGLFYRNDIGSKAIK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_5(2YW2)
PUR2_AQUAE
[Raw transfer]




ATP_A_5(2YW2)
PUR2_AQUAE
[Raw transfer]




ANP_A_2(2XCL)
PUR2_BACSU
[Raw transfer]




ANP_A_2(2XCL)
PUR2_BACSU
[Raw transfer]




ATP_B_6(2YW2)
PUR2_AQUAE
[Raw transfer]




ATP_A_8(2QK4)
PUR2_HUMAN
[Raw transfer]




ATP_A_8(2QK4)
PUR2_HUMAN
[Raw transfer]




AMP_A_4(2YRX)
?
[Raw transfer]




GLY_A_2(2YS6)
?
[Raw transfer]




2 PsiBlast_PDB 93.7452%-103 - C1 -2YRW - ? -
4 PsiBlast_PDB 93.3952%-100 - C1 -2YS6 2.3 ?
3 PsiBlast_PDB 92.8452%-101 - C1 -2YRX - ? -
6 PsiBlast_PDB 90.6551% -88 - C1 -2XCL 5.3 PUR2_BACSU
1 PsiBlast_PDB 90.1652% -85 - C1 -2XD4 - PUR2_BACSU -
21 PsiBlast_CBE 88.6446% -88 - C1 -2YW2 6.0 PUR2_AQUAE
9 PsiBlast_PDB 88.4846% -89 - C1 -2YYA - PUR2_AQUAE -
10 PsiBlast_PDB 88.4544% -98 - C1 -2QK4 5.7 PUR2_HUMAN
8 PsiBlast_PDB 87.5346% -88 - C1 -2YW2 6.3 PUR2_AQUAE
25 HHSearch 86.5249% -86 - C1 -2XCL 5.3 PUR2_BACSU
26 HHSearch 85.8749% -92 - C1 -2YRX 3.6 ?
11 PsiBlast_PDB 84.1545% -91 - C1 -3MJF - PUR2_YERPE -
29 HHSearch 83.2342% -89 - C1 -2QK4 5.7 PUR2_HUMAN
12 PsiBlast_PDB 83.1239% -94 - C1 -3LP8 - ? -
27 HHSearch 82.2044% -83 - C1 -2YW2 6.3 PUR2_AQUAE
13 PsiBlast_PDB 80.6541% -89 - C1 -2IP4 - ? -
30 HHSearch 79.3543% -86 - C1 -3MJF - PUR2_YERPE -
31 HHSearch 77.7237% -83 - C1 -3LP8 - ? -
28 HHSearch 76.6741% -84 - C1 -2IP4 - ? -
14 PsiBlast_PDB 72.5534% -73 - C1 -1VKZ - PUR2_THEMA -