@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu09410: (2016-06-14 )
MKKMSLFQNMKSKLLPIAAVSVLTAGIFAGAELQQTEKASAKKQDKAEIRNVIVMIGDGMGTPYIRAYRSMKNNGDTPNNPKLTEFDRNLTGMMMTHPDDPDYNITDSAAAGTALATGVKTYNNAIGVDKNGKKVKSVLEEAKQQGKSTGLVATSEINHATPAAYGAHNESRKNMDQIANSYMDDKIKGKHKIDVLLGGGKSYFNRKDRNLTKEFKQAGYSYVTTKQALKKNKDQQVLGLFADGGLAKALDRDSKTPSLKDMTVSAIDRLNQNKKGFFLMVEGSQIDWAAHDNDTVGAMSEVKDFEQAYKAAIEFAKKDKHTLVIATADHTTGGFTIGANGEKNWHAEPILSAKKTPEFMAKKISEGKPVKDVLARYANLKVTSEEIKSVEAAAQADKSKGASKAIIKIFNTRSNSGWTSTDHTGEEVPVYAYGPGKEKFRGLINNTDQANIIFKILKTGK

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_21(3E2D)
?
[Raw transfer]




EDO_A_21(3E2D)
?
[Raw transfer]




EDO_A_21(3E2D)
?
[Raw transfer]




PAE_A_15(1EW8)
PPB_ECOLI
[Raw transfer]




PAE_B_16(1EW8)
PPB_ECOLI
[Raw transfer]




AF3_B_10(1KH5)
PPB_ECOLI
[Raw transfer]




AF3_B_8(1KHJ)
PPB_ECOLI
[Raw transfer]




AF3_A_9(1KH5)
PPB_ECOLI
[Raw transfer]




AF3_A_7(1KHJ)
PPB_ECOLI
[Raw transfer]




MMQ_A_13(1EW9)
PPB_ECOLI
[Raw transfer]




GOL_B_12(4YR1)
PPB_ECOLI
[Raw transfer]




MMQ_B_14(1EW9)
PPB_ECOLI
[Raw transfer]




GOL_A_7(4YR1)
PPB_ECOLI
[Raw transfer]




CHAIN_C_3(3DPC)
PPB_ECOLI
[Raw transfer]

-

21 PsiBlast_CBE 97.5539% -64 - C5 -3A52 - ? -
1 PsiBlast_PDB 97.1939% -63 - C5 -3A52 - ? -
106 HHSearch 96.6239% -61 - C5 -3A52 - ? -
102 HHSearch 93.7333% -55 - C5 -3E2D Error ?
104 HHSearch 93.0630% -55 - C5 -3WBH - ? -
94 Fugue 91.8533% -54 - C5 -3E2D Error ?
103 HHSearch 89.0734% -44 - C5 -2X98 - ? -
11 PsiBlast_PDB 87.5634% -37 - C5 -2X98 - ? -
31 PsiBlast_CBE 86.9334% -38 - C5 -2X98 - ? -
105 HHSearch 84.0235% -30 * C5 *3TG0 - PPB_ECOLI -
108 HHSearch 82.5130% -39 - C5 -1ZED - PPB1_HUMAN -
92 Fugue 81.8433% -25 - C5 -1ED9 - PPB_ECOLI -
107 HHSearch 81.2729% -43 - C5 -1K7H - ? -
109 HHSearch 79.8034% -51 - C5 -2W5V - ? -
3 PsiBlast_PDB 79.5935% -54 - C5 -3E2D Error ?
23 PsiBlast_CBE 78.7935% -53 - C5 -3E2D - ? -
22 PsiBlast_CBE 78.2434% -46 - C5 -3WBH - ? -
2 PsiBlast_PDB 78.0134% -48 - C5 -3WBH - ? -
37 PsiBlast_CBE 77.3432% -12 - C5 -3BDH - PPB_ECOLI -
13 PsiBlast_PDB 77.2232% -10 - C5 -1KH5 2.8 PPB_ECOLI
33 PsiBlast_CBE 76.7932% -9 - C5 -1KH5 2.7 PPB_ECOLI
47 PsiBlast_CBE 76.5332% -12 - C5 -1EW8 3.9 PPB_ECOLI
74 PsiBlast_CBE 76.3431% -18 - C5 -3DPC Error PPB_ECOLI
46 PsiBlast_CBE 75.9832% -12 - C5 -1EW9 2.6 PPB_ECOLI
48 PsiBlast_CBE 75.8432% -11 - C5 -1EW8 3.2 PPB_ECOLI
45 PsiBlast_CBE 75.8032% -9 - C5 -1EW9 2.9 PPB_ECOLI
28 PsiBlast_CBE 75.2632% -12 - C5 -1KHJ 2.7 PPB_ECOLI
90 PsiBlast_CBE 74.9631% -11 - C5 -4YR1 0.8 PPB_ECOLI
5 PsiBlast_PDB 74.8532% -10 - C5 -1KHJ 2.6 PPB_ECOLI
91 PsiBlast_CBE 74.4431% -8 - C5 -4YR1 1.3 PPB_ECOLI