@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22660: (2016-07-05 )
MLEKIIKQKKEEVKTLVLPVEQPFEKRSFKEALASPNRFIGLIAEVKKASPSKGLIKEDFVPVQIAKDYEAAKADAISVLTDTPFFQGENSYLSDVKRAVSIPVLRKDFIDSLQVEESRRIGADAILLIGEVLDPLHLHELYLEAGEKGMDVLVEVHDASTLEQILKVFTPDILGVNNRNLKTFETSVKQTEQIASLVPKESLLVSESGIGSLEHLTFVNEHGARAVLIGESLMRQTSQRKAIHALFRE

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

137_B_2(1LBF)
TRPC_SULSO
[Raw transfer]




137_B_2(1LBL)
TRPC_SULSO
[Raw transfer]




137_P_8(1JCM)
TRPC_ECOLI
[Raw transfer]




IGP_A_2(3T44)
TRPC_MYCTU
[Raw transfer]




4RG_A_2(3T55)
TRPC_MYCTU
[Raw transfer]




BE2_A_3(3T44)
TRPC_MYCTU
[Raw transfer]




UNL_B_6(3TSM)
TRPC_BRUA2
[Raw transfer]




5RG_A_2(3T78)
TRPC_MYCTU
[Raw transfer]




MES_B_2(1JUL)
TRPC_SULSO
[Raw transfer]




ACY_B_14(1VC4)
?
[Raw transfer]




IGP_B_2(1A53)
TRPC_SULSO
[Raw transfer]




21 PsiBlast_CBE 74.1148% -32 - C1 -3TSM 2.8 TRPC_BRUA2
1 PsiBlast_PDB 74.1048% -33 - C1 -3TSM - TRPC_BRUA2 -
42 HHSearch 72.9345% 27 - C1 -3TSM - TRPC_BRUA2 -
4 PsiBlast_PDB 71.2339% -11 - C1 -1VC4 - ? -
45 HHSearch 69.8239% -20 * C1 *1VC4 - ? -
23 PsiBlast_CBE 67.9739% -6 - C1 -1VC4 3.1 ?
7 PsiBlast_PDB 67.5737% -49 - C1 -3T78 3.1 TRPC_MYCTU
2 PsiBlast_PDB 67.4638% -48 - C1 -1I4N - TRPC_THEMA -
22 PsiBlast_CBE 65.7938% -44 - C1 -1I4N - TRPC_THEMA -
63 Fugue 65.1835% -16 - C1 -1PII - ? -
6 PsiBlast_PDB 63.9937% -45 - C1 -3T55 5.6 TRPC_MYCTU
43 HHSearch 63.9235% 18 - C1 -1PII - TRPC_ECOLI -
44 HHSearch 63.7434% 12 - C1 -3QJA - TRPC_MYCTU -
9 PsiBlast_PDB 63.6836% -52 - C1 -1JCM 6.9 TRPC_ECOLI
3 PsiBlast_PDB 63.6038% -48 - C1 -1J5T - TRPC_THEMA -
5 PsiBlast_PDB 63.4837% -44 - C1 -3T44 6.3 TRPC_MYCTU
41 HHSearch 61.9035% 38 - C1 -1I4N - TRPC_THEMA -
8 PsiBlast_PDB 60.7436% -50 - C1 -1PII - TRPC_ECOLI -
10 PsiBlast_PDB 60.5537% -40 - C1 -4FB7 - TRPC_MYCTU -
15 PsiBlast_PDB 58.4534% -24 - C1 -1LBL 7.0 TRPC_SULSO
16 PsiBlast_PDB 58.3434% -22 - C1 -1A53 6.0 TRPC_SULSO
14 PsiBlast_PDB 58.3334% -22 - C1 -1LBF 7.4 TRPC_SULSO
13 PsiBlast_PDB 58.1834% -25 - C1 -1JUL 2.2 TRPC_SULSO