@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu24280: (2016-07-08 )
MTNKLTSFLADRKKTIENQLSVYTEKLDMPDSLKKSMLYSLQAGGKRLRPLIVLAVLNAYGKSEKDGIPVGCAVEMIHTYSLIHDDLPCMDDDDLRRGKPTNHKVFGEATAVLAGDGLLTESFKLITSHVSDEVSAEKRLRLVNELISAAGTEGMVGGQVADMEAENRQVTLEELESIHERKTAKLLGFCVIAGAILADAPEEDIETLRTFSSHIGIGFQIRDDILDLEGSEEKIGKRVGSDTTNDKSTYPSLLSLEGAKHKLDVHIKEAKRLIGGLSLQKDLLYELCDLIAARDH

Atome Classification :

(56 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IPE_D_7(3KRC)
?
[Raw transfer]




GPP_D_9(3KRP)
?
[Raw transfer]




IPR_A_9(1RQJ)
ISPA_ECOLI
[Raw transfer]




GRG_A_3(2J1P)
GGPPS_SINAL
[Raw transfer]




IPE_B_7(4LFE)
?
[Raw transfer]




IPE_A_4(4LFG)
?
[Raw transfer]




IPE_B_9(4LFG)
?
[Raw transfer]




DMA_B_12(4GP2)
?
[Raw transfer]




IPE_A_4(4LFG)
?
[Raw transfer]




IPR_B_11(1RQJ)
ISPA_ECOLI
[Raw transfer]




DMA_A_6(4GP2)
?
[Raw transfer]




GOL_C_16(3M9U)
?
[Raw transfer]




IPE_A_5(3KRC)
?
[Raw transfer]




GOL_B_5(4F62)
?
[Raw transfer]




GOL_A_4(4F62)
?
[Raw transfer]




GOL_A_4(4F62)
?
[Raw transfer]




RIS_B_12(1RQJ)
ISPA_ECOLI
[Raw transfer]




RIS_A_10(1RQJ)
ISPA_ECOLI
[Raw transfer]




RIS_A_10(1RQJ)
ISPA_ECOLI
[Raw transfer]




IPE_A_4(3WJO)
?
[Raw transfer]




DMA_A_3(4GP1)
?
[Raw transfer]




IPE_A_4(4LLT)
?
[Raw transfer]




GST_A_4(4LLS)
?
[Raw transfer]




DST_D_11(3KRF)
?
[Raw transfer]




DST_D_6(3OAC)
?
[Raw transfer]




DST_B_9(1RQI)
ISPA_ECOLI
[Raw transfer]




GST_A_4(4LLS)
?
[Raw transfer]




DST_A_10(1RQI)
ISPA_ECOLI
[Raw transfer]




IPE_B_9(4LLT)
?
[Raw transfer]




PPV_A_5(3OAB)
?
[Raw transfer]




IPE_B_7(3OYR)
?
[Raw transfer]




PPV_A_5(3KRF)
?
[Raw transfer]




DST_D_11(3OAB)
?
[Raw transfer]




IPE_A_5(3KRO)
?
[Raw transfer]




GST_B_9(4LLS)
?
[Raw transfer]




IPE_A_7(3Q1O)
?
[Raw transfer]




IPE_C_18(3Q1O)
?
[Raw transfer]




IPE_A_6(3PDE)
?
[Raw transfer]




IPE_B_13(3Q1O)
?
[Raw transfer]




IPE_D_24(3Q1O)
?
[Raw transfer]




DST_D_11(3KRO)
?
[Raw transfer]




IPE_B_13(3PDE)
?
[Raw transfer]




IPE_A_6(3PDE)
?
[Raw transfer]




IPE_A_3(4LFE)
?
[Raw transfer]




POP_A_3(3OYR)
?
[Raw transfer]




IPE_C_15(3PDE)
?
[Raw transfer]




IPE_D_22(3PDE)
?
[Raw transfer]




2DE_D_13(3AQC)
HEXB_MICLU
[Raw transfer]




2DE_B_8(3AQC)
HEXB_MICLU
[Raw transfer]




1 PsiBlast_PDB 84.6947% -73 - C- -1RTR - ? -
89 HHSearch 84.1447% -71 - C- -1RTR - ? -
88 HHSearch 77.6339% -32 - C1 -3PDE 3.1 ?
20 PsiBlast_PDB 76.5042% -37 - C1 -3TS7 - ? -
21 PsiBlast_CBE 76.4243% -34 - C1 -3OAC 2.9 ?
7 PsiBlast_PDB 75.7843% -59 - C1 -3KRO 2.4 ?
24 PsiBlast_CBE 75.4543% -33 - C1 -3KRO 3.1 ?
25 PsiBlast_CBE 75.0643% -36 - C1 -3KRF 2.9 ?
96 HHSearch 74.9339% -95 - C1 -5E8K - GGPPA_ARATH -
6 PsiBlast_PDB 74.8943% -60 - C1 -3KRF 3.1 ?
4 PsiBlast_PDB 74.6743% -57 - C1 -3KRA - ? -
22 PsiBlast_CBE 74.3143% -37 - C1 -3OAB 2.8 ?
13 PsiBlast_PDB 73.8545% -77 - C1 -2J1P 8.0 GGPPS_SINAL
83 HHSearch 73.5241% -21 - C1 -3TS7 - ? -
90 HHSearch 73.3742% -58 - C1 -3M0G - ? -
9 PsiBlast_PDB 73.3543% -64 - C1 -3OAB 3.0 ?
38 PsiBlast_CBE 73.3142% -34 - C1 -3TS7 - ? -
27 PsiBlast_CBE 73.0043% -61 - C1 -3KRA - ? -
26 PsiBlast_CBE 72.4843% -63 - C1 -3KRC 3.7 ?
10 PsiBlast_PDB 72.2543% -60 - C1 -3OAC - ? -
5 PsiBlast_PDB 72.2443% -61 - C1 -3KRC 2.8 ?
23 PsiBlast_CBE 70.0643% -51 - C1 -3KRP 4.6 ?
85 HHSearch 69.5242% -1 - C1 -1RQJ 4.0 ISPA_ECOLI
48 PsiBlast_CBE 69.0742% 2 - C1 -1RQJ 4.8 ISPA_ECOLI
47 PsiBlast_CBE 67.4542% -0 - C1 -1RQJ 4.8 ISPA_ECOLI
45 PsiBlast_CBE 66.5042% 0 * C1 *1RQI 3.1 ISPA_ECOLI
46 PsiBlast_CBE 65.9142% 2 - C1 -1RQI 3.4 ISPA_ECOLI
29 PsiBlast_CBE 64.1644% -6 - C1 -3PDE 3.0 ?
15 PsiBlast_PDB 64.1544% -8 - C1 -3PDE 3.1 ?
94 HHSearch 63.5437% -27 - C1 -4LLS 5.7 ?
92 HHSearch 62.7339% 0 - C1 -4LFG 5.4 ?
81 HHSearch 62.2838% -61 - C1 -4F62 2.4 ?
32 PsiBlast_CBE 61.9944% -16 - C1 -3M9U 2.3 ?
31 PsiBlast_CBE 61.1644% -7 - C1 -3PDE 3.1 ?
17 PsiBlast_PDB 59.4341% 9 - C1 -4LFG 5.4 ?
35 PsiBlast_CBE 59.4041% 9 - C1 -4LFE 5.1 ?
34 PsiBlast_CBE 59.2341% 9 - C1 -4LFG 5.2 ?
30 PsiBlast_CBE 58.8044% -9 - C1 -3PDE 3.4 ?
16 PsiBlast_PDB 58.3841% -6 - C1 -4LFE 3.1 ?
19 PsiBlast_PDB 57.7140% -50 - C1 -4F62 2.4 ?
36 PsiBlast_CBE 57.2340% -57 - C1 -4F62 1.9 ?
41 PsiBlast_CBE 55.6341% -17 - C1 -4LLS 5.2 ?
39 PsiBlast_CBE 55.3641% -16 - C1 -4LLT 3.4 ?
40 PsiBlast_CBE 54.0541% -17 - C1 -4LLT 3.8 ?
42 PsiBlast_CBE 52.5941% -18 - C1 -4LLS 5.7 ?
58 PsiBlast_CBE 44.7532%-109 - C1 -3WJO 3.5 ?
53 PsiBlast_CBE 42.3438% -9 - C1 -3Q1O 3.9 ?
54 PsiBlast_CBE 41.4838% -7 - C1 -3Q1O 4.0 ?
55 PsiBlast_CBE 40.6238% -7 - C1 -3Q1O 4.1 ?
52 PsiBlast_CBE 36.1438% -0 - C1 -3Q1O 3.9 ?
62 PsiBlast_CBE 33.4231% -52 - C1 -4GP2 4.8 ?
66 PsiBlast_CBE 31.4434% -43 - C1 -3OYR 3.5 ?
64 PsiBlast_CBE 30.6731% -49 - C1 -4GP1 4.4 ?
63 PsiBlast_CBE 29.1931% -48 - C1 -4GP2 3.7 ?
67 PsiBlast_CBE 25.4231% -0 - C1 -3AQC 4.1 HEXB_MICLU
68 PsiBlast_CBE 23.5831% -0 - C1 -3AQC 3.4 HEXB_MICLU