@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu36920: (2016-08-01 )
MKVAIASDHGGVHIRNEIKELMDELQIEYIDMGCDCGSGSVDYPDYAFPVAEKVVSGEVDRGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREIAKIWLTTEFTGGRHQTRIGKISDYEEKNL

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

R5P_B_4(3HEE)
?
[Raw transfer]




R5P_A_3(3HEE)
?
[Raw transfer]




RES_B_4(3K8C)
?
[Raw transfer]




R52_B_6(3K7S)
?
[Raw transfer]




R52_C_7(3K7S)
?
[Raw transfer]




R52_D_8(3K7S)
?
[Raw transfer]




RB5_A_3(3PH3)
?
[Raw transfer]




RB5_B_4(3PH3)
?
[Raw transfer]




PSJ_B_5(4LFM)
?
[Raw transfer]




PSJ_D_6(4LFM)
?
[Raw transfer]




RBL_D_6(4LFN)
?
[Raw transfer]




RES_A_3(3K8C)
?
[Raw transfer]




R52_A_5(3K7S)
?
[Raw transfer]




GOL_A_3(3HE8)
?
[Raw transfer]




GOL_B_4(3HE8)
?
[Raw transfer]




RBL_B_5(4LFN)
?
[Raw transfer]




GOL_A_3(3HE8)
?
[Raw transfer]




AOS_B_4(3PH4)
?
[Raw transfer]




MLA_A_2(3SGW)
RPIB_COCIM
[Raw transfer]




MLA_A_2(3SGW)
RPIB_COCIM
[Raw transfer]




4 PsiBlast_PDB 91.2955%-139 - C9 -3PH3 - ? -
3 PsiBlast_PDB 90.7155%-137 - C9 -3PH4 - ? -
22 PsiBlast_CBE 90.4355%-131 - C9 -3HE8 2.5 ?
66 HHSearch 90.4154%-138 - C9 -3PH3 2.1 ?
2 PsiBlast_PDB 90.3255%-131 - C9 -3HEE 3.3 ?
24 PsiBlast_CBE 90.2155%-135 - C9 -3PH3 2.0 ?
1 PsiBlast_PDB 89.7955%-130 - C9 -3HE8 3.3 ?
23 PsiBlast_CBE 89.7755%-135 - C9 -3PH4 2.1 ?
21 PsiBlast_CBE 89.6155%-135 - C9 -3HEE 3.1 ?
65 HHSearch 88.0154%-130 - C9 -3HE8 3.3 ?
64 HHSearch 85.6946%-136 - C9 -2VVR - RPIB_ECOLI -
6 PsiBlast_PDB 84.3647%-142 - C9 -1NN4 - RPIB_ECOLI -
7 PsiBlast_PDB 83.8846%-138 - C9 -2VVR - RPIB_ECOLI -
8 PsiBlast_PDB 83.1146%-159 - C9 -4EM8 - ? -
68 HHSearch 82.8046%-155 - C9 -4EM8 - ? -
67 HHSearch 82.4350%-159 - C9 -3S5P - ? -
5 PsiBlast_PDB 82.4350%-159 - C9 -3S5P - ? -
25 PsiBlast_CBE 79.2150%-150 - C9 -3S5P - ? -
26 PsiBlast_CBE 76.6645% -57 - C9 -3K8C 3.3 ?
10 PsiBlast_PDB 76.3345% -57 - C9 -3K7S 2.4 ?
11 PsiBlast_PDB 76.3045% -55 - C9 -3K8C 3.3 ?
29 PsiBlast_CBE 75.9345% -58 - C9 -3K7S 3.3 ?
27 PsiBlast_CBE 74.9645% -58 - C9 -3K7S 3.3 ?
28 PsiBlast_CBE 74.7545% -57 - C9 -3K7S 3.4 ?
59 PsiBlast_CBE 72.2437%-129 - C9 -4LFN 2.4 ?
72 HHSearch 71.8340% -46 - C9 -3SGW 2.1 RPIB_COCIM
61 PsiBlast_CBE 71.8337%-130 - C9 -4LFM 2.5 ?
60 PsiBlast_CBE 71.1637%-130 - C9 -4LFM 2.4 ?
58 PsiBlast_CBE 70.8237%-129 - C9 -4LFN 2.5 ?
15 PsiBlast_PDB 68.4041% -42 - C9 -3SGW 2.1 RPIB_COCIM