@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3588c: (2016-05-21 )
MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIVVLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHIGNIGEEV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EPE_A_19(1G5C)
?
[Raw transfer]




GOL_A_6(3UCJ)
?
[Raw transfer]




23 PsiBlast_CBE 96.89100%-128 - C6 -2A5V - MTCA2_MYCTU -
2 PsiBlast_PDB 96.58100%-130 - C6 -2A5V - MTCA2_MYCTU -
21 PsiBlast_CBE 96.36100%-131 - C6 -2A5V - MTCA2_MYCTU -
22 PsiBlast_CBE 95.71100%-134 - C6 -2A5V - MTCA2_MYCTU -
109 HHSearch 94.51100%-141 - C6 -1YM3 - MTCA2_MYCTU -
1 PsiBlast_PDB 94.49100%-141 - C6 -1YM3 - MTCA2_MYCTU -
25 PsiBlast_CBE 72.8834%-119 - C6 -1DDZ - ? -
100 Fugue 72.8325%-115 - C6 -1DDZ - ? -
4 PsiBlast_PDB 72.5734%-116 - C6 -1DDZ - ? -
75 PsiBlast_CBE 71.8732%-129 * C6 *5BQ1 - ? -
17 PsiBlast_PDB 71.4830%-126 - C6 -4O1K - ? -
101 Fugue 71.4726%-116 - C6 -1EKJ - CAHC_PEA -
76 PsiBlast_CBE 71.3332%-129 - C6 -4RXY - ? -
40 PsiBlast_CBE 70.4133%-138 - C6 -2A8D - CAN_HAEIN -
111 HHSearch 70.3526%-117 - C6 -1EKJ - CAHC_PEA -
14 PsiBlast_PDB 70.3233%-135 - C6 -3MF3 - CAN_HAEIN -
51 PsiBlast_CBE 70.1333%-138 - C6 -3MF3 - CAN_HAEIN -
47 PsiBlast_CBE 70.0933%-136 - C6 -2A8C - CAN_HAEIN -
12 PsiBlast_PDB 70.0133%-138 - C6 -2A8C - CAN_HAEIN -
46 PsiBlast_CBE 69.9933%-136 - C6 -2A8C - CAN_HAEIN -